(data stored in ACNUC7421 zone)

EMBL: CP001700.PE481

CP001700.PE481       Location/Qualifiers
FT   CDS_pept        complement(550952..552922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0484"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; WD40 domain protein beta Propeller;
FT                   KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69436"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX85"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69436.1"
FT                   /translation="MPEFRKSVTTIAVAAGSLSAVLGMSSAAQADSRSAAAAVSAVAPL
FT                   PGTGLPAVSNGPIYIQGPSGGGFMPVGGGNPVVCDAYASVMAWSPDGSRIACLEAYSAG
FT                   VLRIRNPDDNRVVSAGSVTDYAKPDSPLAKISSLTWFNHGREVVLAQNGSLISVRVDGS
FT                   QPRNPDNSYAPTAMLPGQTGITDVTANAAGTVLAFTQGTSTGASVIVYDTTKPAASALR
FT                   PLAQVSYASQLALSPDGRYLAYVPYTPGQNAPSQIWLYDLKSPASASNPRQVTSDSAVS
FT                   ASNPTWAPDGTRLAFTATSASLAHSVKSFPVADPSSQRVEVPTLTYQSFLWRPLTHKPV
FT                   ERLAGGDRVGTAVATSQSEWEGFGGASTGRRTAKSVTLSRSDLFADALGGAGFAAHQQG
FT                   PLLLTDPKHMDQATMTELRRVLGPGSGPNGPTVYLLGGDSALSPDVQKALVAANYHVER
FT                   IGGANRFDTAVKIAQRDSGTKPSKVLVATGIDYPDALAAGAAAGANANAVVVLTNDKKM
FT                   PPETAAYLNSVAGATVYGVGGQAVAALGNRPQTALKGTDRVATSLLVARNLFDTPGSVG
FT                   FATSMNWPDSLAGGALQGTVGGPLILVAPTTGLSADEQQWLTQSATAINSVQIYGGRAA
FT                   VPAIEAQVGTDIGGVGGFVVK"
     gtgcccgagt tccgcaagtc tgtgacgacg atagccgtcg ccgccggatc gctgtcggct        60
     gtgctgggca tgtcgtcggc tgctcaggcc gattcgcggt ccgctgctgc tgcggtgtcg       120
     gcggtcgccc cgctgccggg gacggggctg cctgctgttt cgaatggccc catctacatt       180
     cagggcccat cggggggcgg cttcatgccg gtcggtggtg gcaatccggt cgtgtgcgat       240
     gcctacgctt ctgttatggc gtggtcgccg gatggcagcc ggatcgcttg tctggaggcc       300
     tacagcgccg gtgttctgcg gatccggaat ccggacgaca acagggtcgt gtctgcgggg       360
     tcggtgaccg actacgcgaa gcccgatagc ccgctggcca agatcagtag cctcacgtgg       420
     ttcaaccacg gtagggaggt cgtgctggcc cagaacggca gcctcatctc ggtgcgcgtt       480
     gacggctccc agcctcggaa cccggacaac agctacgcgc ccacggcgat gctgccggga       540
     cagaccggca tcacggatgt cacggcgaac gcggcgggca ccgtgctggc gttcacgcag       600
     ggcacctcga ccggcgccag cgtcatcgtc tacgacacca cgaagcccgc agcctccgct       660
     ctgcgacctc ttgcgcaggt cagctacgct tcgcagctgg cgctctctcc ggatgggcgg       720
     tacctcgcct acgtgccgta caccccgggc cagaatgcgc cgtcacagat ctggctgtac       780
     gacctgaaga gccccgcctc cgccagcaac ccgcgacagg tgacgtccga ctccgccgtg       840
     tccgccagca atccgacgtg ggctcctgac gggacccgtc tcgcgttcac ggcgacttcc       900
     gcgtcattgg cgcattctgt gaagtcgttc ccggtcgcgg acccgtcctc gcaaagggtc       960
     gaggtcccaa cactcaccta ccagtcgttc ttgtggcgtc ccctcaccca caagccggtg      1020
     gaacggctcg ccggcggcga tcgggtgggc accgccgtcg ccacctcgca gtcggagtgg      1080
     gaaggcttcg gaggcgcgag caccggccgc cgtaccgcca agtcggtcac actgagccgc      1140
     tccgatctgt tcgccgacgc cctcggcggc gccggattcg ccgcgcacca gcaggggccg      1200
     ctgctgctca ccgatcccaa gcacatggat caggccacga tgacggagct gcggcgcgtc      1260
     ctcggtccgg gcagcggtcc gaacgggccg accgtgtact tgctcggtgg tgacagcgcg      1320
     ctctcgcctg acgtgcagaa ggcgctcgta gccgcgaact accacgtcga gcgcatcggt      1380
     ggcgccaacc ggttcgacac cgcggtcaag atcgcgcagc gggacagcgg caccaagccg      1440
     agcaaagtcc tcgtcgccac cggcatcgac tacccggacg ccctggccgc cggcgcggcg      1500
     gcgggtgcga acgccaacgc cgtcgtggtg ctgacgaacg acaaaaagat gcctccggag      1560
     acggccgcct acctgaacag cgtcgccggc gcgactgtct acggcgtagg cggccaggcg      1620
     gtggccgcgc tgggtaatcg gccgcagaca gcgctcaagg gcacggaccg cgtcgccacc      1680
     tctttgctgg tggcccggaa cctgttcgac acgcccggct cagtcggatt cgcgacgagc      1740
     atgaactggc cggactcgct ggccggcggt gcgctgcagg gcacggtcgg aggtccgctg      1800
     atcctggtcg ccccgacgac cggcctttcc gcggacgagc aacagtggct gacccagtcc      1860
     gcgaccgcga tcaactcggt acagatctac ggtggacggg cggctgtgcc cgcaatcgaa      1920
     gcccaggtcg ggaccgacat cgggggcgtc ggcggcttcg tcgtcaagta a               1971
//

If you have problems or comments...

PBIL Back to PBIL home page