(data stored in ACNUC7421 zone)

EMBL: CP001700.PE482

CP001700.PE482       Location/Qualifiers
FT   CDS_pept        complement(553873..556104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: paa:Paes_2382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69437"
FT                   /db_xref="GOA:C7PX86"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69437.1"
FT                   /translation="MRDFTVLSDREFEELVADLLQARFGTHVERFPPGRDGGVDLRWRS
FT                   GAETVIGQCKHYARSGYSALLRELRRETKKVAKRKPDDYWVVTSVDLTSHRKDEIHGLF
FT                   QPWMRSSANVLGPLDLDGMLTEFTAVERRHVKLLFSTGEQLTALVHSGIVNRTQALLKR
FT                   IERARPAYAVTDAHRRAAELLEKHRVCVLVGPPGIGKTSLGMMLVAQAIGDGCQPVEVS
FT                   EDIDDAFAMLRAGEKQIFFYDDFLGELSYGERWGRKNEQKRIGHFIDHVAQSSSALLVM
FT                   TSREYILRDAGRMLETVRRVAAEPFVLRLAEIPPPDSGRVLYNHLWHAGLPDTARHDLA
FT                   GSGWTRIAGHHGFNPRVVEWCVQPEFVGDGGRYVSRVVDALDNPETIWETVFNGLPEFD
FT                   RLVLYVLSTLHGRFSTVEWASTVLDALCRETGLRFTGDDLRRALDVLEGTFTRIELVTH
FT                   WSSGEQEAVREVRFMNPSIRAFVLGRIAADVFACRAVLRTATDLNALELLWFGDEQGLM
FT                   DGLRLWPSRLSPQVRAEFVAAAQRLTDRSQRYYRAILFWNCMPHEWLPDRAWLTRAMEA
FT                   HIVELAADDEEDTIDPFTYNVVLRDLAGTDVGMRLHACVDAKTDVDRFENYLDDWDRLA
FT                   EHIRIHRRSCDLAGSAKVLESYEGFVDGELERMRETSGGPDIENLLQMASIAGILGLPG
FT                   LMQRLRDAVQLVRTSDGDGYPQQVAESIQVSWGTDLVQDFDRLLRPEHS"
     gtgcgtgact tcaccgtcct ctccgaccgc gagttcgaag aactggtggc ggacttgctc        60
     caggccaggt tcggcacaca cgtggagcgg ttcccgccgg ggcgggatgg tggcgtcgac       120
     cttcgatggc ggtcgggcgc ggagaccgtg atcgggcagt gcaagcacta tgcccggtct       180
     ggttatagcg ccttgcttcg tgagctgcgt cgtgagacga agaaagtcgc caagcgcaag       240
     cctgatgact actgggtggt cacgtcggtc gatctcacca gccacaggaa ggacgagatc       300
     cacggcctct tccagccgtg gatgcgatct tcagcgaacg tcctgggtcc tctcgacctg       360
     gacggcatgc tgactgaatt caccgctgtc gagcgtcggc acgtaaagct gctgttctcc       420
     accggtgagc aactgaccgc actggtgcac tcaggcatcg tgaatcgcac gcaagctctt       480
     ctgaaacgaa tcgaacgggc acgtccagcc tatgcggtta ccgacgcaca tcgcagggcc       540
     gcagagcttc tggagaagca tcgggtctgc gtcctcgtcg gtccacccgg catcggcaag       600
     acatcgctcg gcatgatgtt ggtcgcgcag gctatcggtg acggatgtca gccagtcgag       660
     gtgtccgagg acatcgacga cgccttcgcc atgcttcgtg cgggcgagaa gcagatcttc       720
     ttctacgacg acttcctcgg tgagctctcc tatggcgaac gctgggggcg gaagaacgaa       780
     cagaagcgaa tcgggcactt tatcgatcac gtcgcgcaga gctcgagcgc gctactcgtc       840
     atgaccagcc gggagtacat cctgcgtgac gccgggagga tgctcgaaac agtgagaagg       900
     gtcgctgccg agcccttcgt cctgcgcctc gctgagatcc cgcctcctga ttcggggcgg       960
     gtgctgtaca accacctctg gcatgcgggc ctgcctgaca ccgcccggca cgacctggct      1020
     gggagcggct ggacgcggat cgccgggcat cacggcttca acccacgggt cgtcgaatgg      1080
     tgcgtccagc ctgaattcgt cggcgacggc ggccgctacg tctcccgagt cgtggacgca      1140
     ctagacaatc ctgaaacgat ctgggagacc gtgttcaacg ggctccccga gttcgaccgg      1200
     ctcgtactct acgtcctcag caccctgcac ggcagattca gcactgtgga atgggccagt      1260
     acagttcttg atgcgttgtg ccgggagacg ggattgcgct tcaccggaga cgacttgcgc      1320
     cgggccctgg atgttcttga gggaacgttc acgagaatcg aattggtgac ccactggtct      1380
     tcgggagagc aggaggcggt tcgcgaggtc cgtttcatga acccgtccat ccgagcgttc      1440
     gttctcggca ggatcgctgc ggacgtcttc gcctgcaggg ccgtgctccg taccgccaca      1500
     gatctcaacg cgttggaact gttgtggttc ggcgacgagc agggactgat ggacgggctc      1560
     agactctggc cgtcgaggct tagcccgcag gtccgtgcgg aattcgtggc cgcagcccaa      1620
     cgcttgaccg atcggtcgca gcgctactac cgcgcgattc tcttctggaa ctgcatgcct      1680
     catgagtggc ttccagatcg agcatggctg acacgcgcca tggaggcgca catcgtcgag      1740
     ttggcagcgg acgatgagga ggacacgatc gatccgttta cttacaacgt cgtgctgagg      1800
     gaccttgcag gaacggatgt cgggatgcgg ctccacgcgt gcgtcgacgc gaagacagat      1860
     gtcgaccgct tcgagaacta tctcgacgac tgggacaggc tggctgagca catcaggatt      1920
     catcggcgaa gctgcgatct cgcaggctct gccaaagtcc tggagtcgta tgagggtttc      1980
     gtcgacggcg agcttgagcg catgcgggag acgtcgggcg ggccggatat cgagaacctt      2040
     ctccagatgg catccatcgc cggcatcctt ggcttgccgg gcctcatgca acgcctccgt      2100
     gatgcagtcc agctggtaag gacgagcgac ggcgatggtt atccgcagca ggtggccgaa      2160
     tcgatacagg tcagctgggg cacagacctg gtccaggact tcgacaggct ccttcgaccc      2220
     gagcattctt ga                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page