(data stored in ACNUC7421 zone)

EMBL: CP001700.PE483

CP001700.PE483       Location/Qualifiers
FT   CDS_pept        complement(556566..557876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69438"
FT                   /db_xref="InterPro:IPR013495"
FT                   /db_xref="InterPro:IPR024465"
FT                   /db_xref="InterPro:IPR024466"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX87"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1081"
FT                   /protein_id="ACU69438.1"
FT                   /translation="MAGPDVPTDRVDHNRLRRLLGAPELAWLVDRVVERLAAGTTAADG
FT                   AVALTDPSPEQRRAVERLLGRPPGRGRTLTIRLGDVEAVLRDAEISPDGLAAAVTALRG
FT                   PIPVRHETAAAERTAWDSAHEPLEHLVAVRPDLAPWLRHVRATGLLKRHAPTSGTALDL
FT                   AGQAARVLAALPHPGTVRPILAAGAVGDAHALDDGRPLTALVLSAIRSLSGLAAADTTH
FT                   AEGRRAAWAGVGVATDHLSSRVLVLNVPPPPGDDSTLSRLLRLMATDGEPVTLTLRQLR
FT                   ALPAGHADLAGQTVSVCENPAVISAAADALGAACPPLLCLEGTPSVAAISLLRWILGRG
FT                   ARVRYHGDFDSGGIRIAVQVFALAARAGVPAVPWRYDSAAYLDAVALGLGSPLSAPVSP
FT                   DAPWDPDLRHHLETNAVRVEEEHVVDMLLGDLACGDC"
     atggccggcc ccgatgtccc gaccgatcgc gtcgatcaca accgcctgcg ccgcctgctc        60
     ggcgcgccgg aactcgcctg gctggtcgac cgggtcgtcg aacggctcgc ggccgggacc       120
     accgcagccg acggcgccgt cgccctgacc gacccaagtc cggagcagcg ccgggccgtc       180
     gagcgcctgc tcggccgccc gcccggtcgc ggcaggaccc tgacgattcg gctcggcgac       240
     gtagaggccg tgctgcgtga tgccgagatc agcccggatg gtctggccgc agccgtcacc       300
     gccctgcgcg gtccgatccc ggtccgccac gagaccgcag ccgccgaacg gacggcctgg       360
     gactccgctc acgaacctct ggagcacctg gtcgccgtcc gtcccgattt ggcgccatgg       420
     cttcgtcatg tccgggcgac cggcctgctc aagcggcacg ctccgacgtc cgggacggcc       480
     ctcgacctcg ccggtcaggc cgcacgggtc ctggccgcgc tgccgcatcc gggcacggtc       540
     cgcccaatcc tcgccgccgg cgccgtcggc gacgcgcacg cattggatga cggccgcccg       600
     ctgaccgccc tcgtcctgtc cgccatccgc tccctgtcgg gtctggccgc cgccgacacc       660
     acacacgccg agggccgccg cgcggcctgg gcgggcgtcg gcgtcgccac cgaccacctg       720
     tcgtcccgcg tcctggtcct caacgtcccg ccaccgcccg gcgacgacag caccctgtca       780
     cgcctgctgc gcctgatggc gaccgacggc gaaccggtga cgctgaccct ccgccagctg       840
     cgggcattgc ccgccggcca cgcggacctg gccggacaga cggtgagcgt ctgtgagaac       900
     ccggcggtga tctcggcggc ggccgatgcc ctcggcgcag cgtgcccgcc gctgctgtgc       960
     ctggagggca ccccgtcggt agctgccatc agcctgctcc gctggatcct gggcagggga      1020
     gcccgggtcc gctaccacgg cgatttcgac tcgggcggaa tccgcatcgc cgtccaggtt      1080
     ttcgccctcg ccgcccgcgc tggcgtgccc gccgttccct ggcggtatga cagcgccgca      1140
     tacctcgacg ccgtcgcgct gggtctcggc agcccgctgt cggcaccggt gtcgcccgac      1200
     gcgccgtggg accccgacct gcgccaccat ctcgagacca atgctgtccg cgtcgaggag      1260
     gagcacgttg tggacatgct cctgggtgac ctcgcttgcg gagactgctg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page