(data stored in ACNUC7421 zone)

EMBL: CP001700.PE484

CP001700.PE484       Location/Qualifiers
FT   CDS_pept        complement(557882..562102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69439"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX88"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1082"
FT                   /protein_id="ACU69439.1"
FT                   /translation="MTTMTADPTDLPCPSRDRWQPLRAGLVDVFYYDAEEFRFYDGRLL
FT                   LRGNNGTGKSKVLALTLPFLLDGELTPSRVEPDGDRAKRMEWNLLLGGKHPNDERLGYT
FT                   WLEFGRLDENGVPQYRTVGCGLKAVKGRGIADHWFFVTDERVGPGLPLRNEHRVSYSRK
FT                   ALEEKIGAHAVFTTAKAYRRAVDEALFGLGAERYEALVNLLIQLRQPQLSKKPDEKLLS
FT                   KALTEALPPLADGLVGEIAEAFRGLQDERDALAALIEAHGAANAFLAHYRRYAQVAAKR
FT                   IAAGVRQSHSRYEQLGRDLGAATAAREQAHAAFTTAEGELTELDERQTLLTAQKDAYNR
FT                   DPAMGTAREIDRLAKAAETLAAVARTRAEDRHRAVRDADSWMHRSEQARQRAQSDAADV
FT                   DGRHREADAAGQAAGIDHGTLRSVIAAASAQADPPAPPIPSREASEDSIAAVEAAVAVA
FT                   RRSSDALIRDRQQAISGLRNLHQASETAARALAAARAAAERAAQRATASAEHAAASSGA
FT                   VAARGESLVAAWESWNSHCVETVLPDRDAAGSELELWVRTLDGPNPFARRAEEAGRVHA
FT                   AHLNRRVADVDGRRTRAEAERSALAAEIARLEQGGHNAPPAPRTRAADARSDRPGAPLW
FT                   KVVDYQDHVTAADRAGLEAALEASGLLDAWLAPDGRLLDDVTGDVVLAPTAAAPDVGLA
FT                   AVLRPAIDTADPQAAALEETAVAAVLAAIGGVPVGAAEPGHHTWISPDGRFRVGVLRGA
FT                   WRKESAHYIGERARETARRARLAELAGQTARLAAEIAALTGEARTVTARLDALAAELRE
FT                   QPSDAALREANTLAAAHADAAREAVAARDEALAAVEPAAEAAAEAVAATLTFAEDTRLP
FT                   AEAAALEAVAEALADYRHSLSGLWPAVTAAARAAAEAAMAEHERRVATARLAEADEAGL
FT                   AARHDAEAAAEEHRALVATSGAAVEELYRRLEAVRVELAAASAAATAVRARREQALKDR
FT                   ERAEGRRLQLESDIAEVAGLRDEAITVLRRFTATGLLAAALPDLEHPDPAEAWVPAPAV
FT                   TLARAIDAALAAVDEADGAWERVQARVVREQQELSGALARHGHQVGMTLQDGLMVVDVL
FT                   FAGRTQDIPALTSALDAEVAQRTRLLSAKERELLENHLVGEVAGALQELITEAEATVQA
FT                   MNDDLEARPTSTGMALRLVWRTAKGAPEGLEAIRTRLLRKAVDAWSPADRAAVGDFLAR
FT                   RITDDRAANPADTWHDQLTRAFDYRAWHEFGIQRRTDGAWTSASGPASGGERVLAASVP
FT                   LFAAASSHYSSGHPHAPRLIALDEAFAGVDDDSRAKCLGLLAAFDLDVVMTSEREWACY
FT                   PTVPGIGIAQLARAEGVDAVLVTPWRWDGRDRLRLTRPEPYLPPQRARDTPVPTDFEPS
FT                   LFDD"
     gtgacgacga tgacagccga cccgaccgat ctcccgtgcc cgtctcgtga ccggtggcag        60
     ccgctgcgcg cgggtctggt cgacgtgttc tactacgacg ccgaggagtt tcgtttctac       120
     gatgggcgcc tgctgcttcg cggcaacaac ggcaccggga agtccaaagt cctcgcgctc       180
     acgctgccat tcctgctgga cggggagctg accccgtccc gcgtcgaacc ggacggcgac       240
     cgcgccaagc gcatggagtg gaacctgctg ctgggcggca agcacccgaa cgacgagcgc       300
     ctgggctaca cctggctgga gttcggtcgc ctggacgaga acggcgtgcc gcagtaccgg       360
     accgtcggat gcgggctgaa agcggtcaag gggcgtggca tcgccgacca ctggttcttc       420
     gtcaccgatg agcgcgtcgg ccccggtctc ccgctgcgca acgagcaccg cgtctcctac       480
     tcccgcaagg cgttggagga gaagatcggc gcgcatgcgg tgttcaccac ggccaaggct       540
     taccgccggg cggtggacga ggcgctgttc ggcctaggcg ccgaacgcta cgaagcgctc       600
     gtcaacctgc tgatccagct gcggcagccc cagttgtcga agaagcccga tgagaagctg       660
     ttgtccaagg cgctcaccga ggcgttgccg ccgctggccg acggcctcgt cggcgagatc       720
     gccgaggcgt tccgtggcct gcaggacgaa cgggacgcgc tggccgccct catcgaggcg       780
     cacggcgcgg cgaacgcgtt cctcgcccac taccgccgct acgcccaggt cgccgccaag       840
     cgcatcgccg ccggtgtgcg gcagtcgcac agccggtacg agcagctggg gcgggacctc       900
     ggcgcggcga ccgccgcccg cgaacaggcc cacgccgcct tcaccactgc cgagggcgag       960
     ttgaccgagc tcgacgaacg ccagacgctg cttaccgcgc agaaggacgc gtacaaccgt      1020
     gacccggcca tgggcaccgc ccgcgagatc gaccgtctgg cgaaagccgc cgagaccctc      1080
     gccgccgtcg cgcggacccg cgccgaggac cgccatcggg ccgtccgcga cgcggacagt      1140
     tggatgcacc gctccgagca ggcacgacaa cgcgcgcagt ccgatgcggc ggatgtcgac      1200
     ggccggcacc gcgaagccga cgccgcgggg caggccgccg gcatcgatca cggcacgctg      1260
     cgatcggtga tcgccgccgc gtcggcccaa gcggatccgc ccgccccacc gatcccgtcg      1320
     cgcgaagcgt ccgaggactc catcgccgcc gtcgaggccg ccgtcgccgt ggcgcgccgg      1380
     tcgagcgacg cgctgatccg cgaccgacag caggcgatca gtgggctgcg gaacttgcac      1440
     caggcttctg agacggcggc acgcgcgctc gccgccgcac gtgccgccgc cgagcgcgcc      1500
     gcgcagaggg ccacggcctc ggccgagcac gccgccgcct cgtccggcgc cgtcgccgca      1560
     cgcggcgaat ccctggtcgc ggcctgggag tcctggaact cgcactgcgt cgagaccgtc      1620
     ctccccgacc gcgacgcggc cgggtccgag ctcgagctct gggtgaggac actcgatggt      1680
     ccgaacccct tcgcccggcg agccgaggag gccggccgcg tccacgcggc acacctgaac      1740
     cgccgggtcg cggacgtcga tggccgtcgc acacgagccg aagcggagcg ctcggcgctc      1800
     gccgccgaga tagcccgcct ggagcagggc ggccacaacg cgccgccggc tccccggacc      1860
     cgcgccgcgg acgcccggtc ggatcggccc ggcgcgccgc tctggaaggt cgtcgattac      1920
     caggaccacg tcacggccgc cgaccgcgcc ggtttggagg cggcgctgga ggcatcgggc      1980
     ctgctggacg cgtggctcgc cccggacggt cggctcctcg atgacgtcac cggcgacgtg      2040
     gtcctcgcgc cgaccgccgc cgccccggac gtcggcctgg ccgccgtcct gcgccccgcg      2100
     atcgacaccg ccgatccgca ggccgccgcg ctggaggaga ccgcggtcgc ggcggtgctg      2160
     gcggcgatcg gcggcgtccc ggtgggcgcc gcggaacccg gtcaccacac ctggatcagc      2220
     cctgacggcc ggttccgggt cggcgtgctg cgcggcgcct ggcgcaagga atcagcccac      2280
     tacatcggcg agcgcgcccg cgagaccgcc cgccgggccc gcctcgccga actcgccggg      2340
     cagaccgccc ggctggcggc cgagatcgcg gccctcaccg gcgaggcccg caccgtcacc      2400
     gcccgactcg acgccctggc ggccgagctg cgggagcagc cgtccgacgc ggcgctgcgc      2460
     gaggcaaaca ctctcgcggc cgcgcacgcc gacgccgcgc gggaggccgt cgcggcgcgc      2520
     gacgaggccc tggccgccgt cgaaccggcg gctgaggccg ccgccgaagc cgtggcggcg      2580
     acgctgacgt tcgccgagga cacccgcctg cccgccgagg cggcggcgct ggaagccgtc      2640
     gccgaagccc tcgccgacta ccggcacagt ctgtcgggcc tgtggcccgc ggtgaccgcc      2700
     gccgcgcggg ccgccgccga ggccgccatg gcggagcacg agcgccgtgt ggccaccgcc      2760
     cggctggccg aagccgacga ggccgggctc gcggctcgcc acgacgccga ggccgccgcc      2820
     gaggagcacc gcgccttggt ggcgacctcc ggggccgcgg tcgaagagct ctaccggcgg      2880
     ttggaggcgg tccgcgtcga gctggccgcc gcatcggctg ccgccaccgc cgtccgcgcc      2940
     cgccgcgagc aggcgctcaa ggaccgggaa cgggccgagg gccgccgcct ccagctcgag      3000
     tccgacatcg ccgaggtcgc aggcctgcgc gacgaggcca tcacggtcct gcggcgcttc      3060
     accgccaccg gcctgctcgc cgccgcgctg cccgatctcg aacaccccga cccggccgaa      3120
     gcatgggtcc cggccccggc ggtcacgctg gcccgcgcga tcgacgcggc cctggccgcc      3180
     gtcgacgaag ccgacggcgc gtgggagcgc gtccaggccc gggtcgtccg cgaacagcag      3240
     gagctgtccg gcgccctggc ccgccacggc caccaggtcg gcatgaccct gcaggacggc      3300
     ctcatggtcg tcgacgtcct gttcgccggg cgcacccagg acatcccggc tctgacttcc      3360
     gccttggacg ccgaggtcgc gcagcgcacc cgcctgctgt ccgccaagga gcgcgagctg      3420
     ctggagaacc acctcgtcgg cgaggtggcc ggggcgctcc aggaactgat caccgaggcc      3480
     gaagcgaccg tccaggccat gaacgacgac ctggaggccc gacccacctc caccggcatg      3540
     gccctgcgcc tggtctggcg caccgccaag ggcgcgccgg aagggctgga agcgatccgg      3600
     acccggctgc tgcgcaaggc tgtcgacgcc tggagcccgg ccgaccgcgc cgccgtgggg      3660
     gacttcctgg cccgccgcat caccgacgac cgcgccgcca accctgccga cacctggcac      3720
     gaccagctca cccgcgcgtt cgactaccgc gcctggcacg agttcggcat ccagcgccga      3780
     accgacggcg cctggacgtc ggcctcgggc cccgcgtccg gtggcgagcg ggttttggcc      3840
     gcgtccgtgc cgctgttcgc cgccgcgtcg tcgcactact cctccgggca cccgcacgcc      3900
     ccgcggctga tcgccctgga cgaggcgttc gcgggggtcg atgacgactc gcgtgccaag      3960
     tgtctcggcc tgctggccgc gttcgacctc gacgtcgtca tgacgtccga gcgggaatgg      4020
     gcgtgctacc cgactgtgcc gggcatcggc atcgcccagc tggcgcgcgc cgagggcgtc      4080
     gacgcagttc tcgtcacgcc gtggcgttgg gacggccgcg accgcttgcg cctgacgcga      4140
     cccgagccgt acctgccgcc gcagcgcgcc cgcgacacac ctgtcccgac ggactttgag      4200
     ccatcgctgt tcgacgactg a                                                4221
//

If you have problems or comments...

PBIL Back to PBIL home page