(data stored in ACNUC7421 zone)

EMBL: CP001700.PE485

CP001700.PE485       Location/Qualifiers
FT   CDS_pept        complement(562099..563382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69440"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX89"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1083"
FT                   /protein_id="ACU69440.1"
FT                   /translation="MSAVDTAAGQPDPAAFGHTVSDETVTGQTSPHQPSDHHVERRRAA
FT                   RALLASPLLTARDDDFRLVRKHAAELAGWFADQAGWRLTVDAETARLFKKPAALDDATR
FT                   PAHAPKSKVPFTRRRYVLLCLALAVLERSESQTTLGRLAEGVLTGAADPALTEAGITFA
FT                   MERREERADLVAVVRLLLAWGVLTRVQGDEDAFVADSGNDVLYDLDRRVTGGLLATSRS
FT                   ASTVTATAFEQRLTTLAAEPIPDTDDLRLRSLRHAMTRRLLDDPVVYYADLTEPERAYL
FT                   AGQRVAITRRITDLTGLIPEMRAEGIAMVDPDDALTDVRMPEQGTDGHVTLLIATKLAT
FT                   DGMAPTVPELIRFVQAQARLHVSYWRKTAAEPAAAADLAEQAVAKLEALNLVIRVPDDH
FT                   GDVRIHPRSALMRFTMTDPTIKKAGARA"
     atgagcgccg tggacacagc ggccggccaa ccggacccgg ccgcgttcgg ccacaccgtg        60
     tccgacgaga ccgtgaccgg ccagacctcg ccgcaccagc cgtccgatca ccatgtcgag       120
     cgtcgccggg cggcgcgcgc cctgctggcc tcgccgttgc tgaccgcccg cgacgacgac       180
     ttccgcctgg tccgcaagca cgcggccgaa ctggcgggct ggttcgccga ccaagccggc       240
     tggcggctga ccgtggacgc cgagacggcc cggctgttca agaagcccgc cgcgctggac       300
     gatgccaccc gccctgccca cgccccgaag agcaaggtcc cgttcacccg ccgccggtac       360
     gtcctgctct gtctggccct ggctgtcctt gagcggtcgg agtcgcagac gaccctgggc       420
     cgcctggccg aaggcgtcct caccggcgcc gccgacccgg ctttgaccga agccgggatc       480
     acgttcgcca tggagcgccg cgaggagcgc gccgacctgg tcgccgtcgt caggcttctg       540
     ctggcctggg gagtgctgac ccgcgtccaa ggcgacgagg acgccttcgt cgccgacagc       600
     ggaaacgacg tgctctacga cctcgaccgc cgcgtcaccg gcggactgct ggccacctcc       660
     cgcagcgcct cgaccgttac cgcgacggcc ttcgaacaac ggctgacgac actggccgcc       720
     gaaccgatcc ccgacacgga tgacctgcgg ctgcgctcgc tgcggcacgc gatgacccgc       780
     cgactcctgg acgacccggt cgtctactac gccgacctca ccgagcccga acgtgcctac       840
     ctcgccggcc agcgcgtcgc catcacccgc cggatcaccg acctcaccgg tctgatcccg       900
     gagatgcgcg ccgagggcat cgccatggtc gaccccgacg acgccctcac cgacgtccgt       960
     atgcccgagc aaggcaccga cggacacgtc accctgctga tcgccaccaa gctcgccacc      1020
     gatggcatgg ccccgaccgt ccccgagctg atccgcttcg tgcaggcgca ggccaggctc      1080
     cacgtgtcgt attggcgcaa gaccgcagcc gagcccgcgg ccgccgccga cctggccgag      1140
     caggccgtcg ccaagctgga ggccctcaac ctggtgatcc gcgttcccga cgaccacggc      1200
     gacgtccgga tccacccgcg ttcggcactg atgcgcttca ccatgaccga tccgacgatc      1260
     aagaaggccg gagcccgcgc gtga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page