(data stored in ACNUC7421 zone)

EMBL: CP001700.PE486

CP001700.PE486       Location/Qualifiers
FT   CDS_pept        complement(563379..565001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_1084 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69441"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX90"
FT                   /inference="similar to AA sequence:KEGG:Francci3_1084"
FT                   /protein_id="ACU69441.1"
FT                   /translation="MADVTDAPAPQPFAYLGTPNAPLYTGILDVFALAKQRFTVHLRPE
FT                   DVLADWPGARAGDRADAVRPAAEHLVQALDRLVEWGNLRSDADTGRVTTVEDFNRARRI
FT                   YQLTRHGQAALAAIEHYEQTLGQRGRLQTVALADIAEQLSALAVHAEAAEAPDQATVGL
FT                   LLFALTERFTGLADNAEAFMSSLRRTVDFSDGDGDEEAFLAYKDRLIEYIDKFIADLAN
FT                   RGAQIAGLIERIETAGIARILDAAACREAVDALPDVDRADVADAPDVYTAAVQAVTRDW
FT                   ENRWRGLREWFVSSGSRRPSQARLLRNAAVSGITNLVNTVAALNERRGGRSDRSADLRA
FT                   LARFFAQAPDDAAAHRLWRAAFALSPARHLTVDADTEDAWEQAEYPPGTPWAAAASLQI
FT                   SPRLRETGSYERRGAPNRAVDREAGRRQLAERAEREAAEIAEARRLLATDGPVLLSELA
FT                   GDAGLDPRAFRLFLSVLGDALAARRPGIATTTATSGDGTMEIRLKLVDAGQIVTIPTED
FT                   GVLSGPEHVVEIIDLTARPAAVR"
     atggcagacg tgaccgacgc gccggcgcca caacccttcg cttacctcgg caccccgaat        60
     gcgccgctct ataccggcat cctggacgtg ttcgccttgg ccaagcagcg tttcaccgtc       120
     cacctccggc ccgaggacgt cctggcggac tggcccggcg cgcgggccgg cgaccgcgcc       180
     gacgcggttc gtccggcggc tgagcatctg gtccaggccc tggacagact ggtcgagtgg       240
     ggcaacctcc gctccgacgc cgacaccggg cgggtgacca cggtcgagga cttcaaccga       300
     gcccgcagga tttaccagct cacccggcac gggcaggcag cgctggcggc gatcgagcac       360
     tacgagcaga ccctcgggca gcgcggtcgg ctgcagacgg tcgccttggc cgacatcgct       420
     gagcagttgt cggcgctcgc ggtccatgcc gaggcggccg aggcgccgga ccaggccacg       480
     gtcggcctgc tgttgttcgc ccttaccgag cgtttcaccg gcctggccga caacgccgag       540
     gcgttcatgt cctcgttgcg ccgcaccgtc gactttagcg acggcgacgg agacgaggaa       600
     gcgttcctcg cctacaagga ccggctgatc gagtacatcg acaagttcat cgccgacctc       660
     gccaaccggg gagcccagat cgccggactc atcgagcgga tcgagacggc cggcatagcg       720
     cggattctgg acgcagcagc ttgccgggag gcggtcgacg ccctccccga cgtcgaccgt       780
     gccgatgtag cagatgcccc cgacgtgtac accgcggccg tgcaggcggt gacccgcgac       840
     tgggaaaacc gctggcgcgg tctgcgcgag tggttcgtca gctccggatc ccgtcgtccg       900
     tcgcaggccc ggctgctgcg caacgcggcc gtcagcggca tcacgaacct ggtgaacacg       960
     gtcgccgccc tgaacgagcg gcgcggcgga cgatcggacc gctcggcgga cttgcgggcg      1020
     ctggcccgat tcttcgccca ggccccggac gacgccgccg cgcaccgtct gtggcgcgcg      1080
     gcgttcgccc tgtcccctgc acggcatctg accgtggacg ccgacactga ggacgcctgg      1140
     gaacaggccg agtacccgcc ggggacgccg tgggccgccg ctgcgtcgct gcagatcagc      1200
     ccgcgcctgc gcgagaccgg ttcctacgag cggcgcggtg cgccgaacag ggcggtcgac      1260
     cgtgaggcgg gacgccggca gcttgccgag cgggccgagc gcgaggccgc cgagatcgcc      1320
     gaggcgcggc ggctgctggc gaccgatggt ccggtcctgt tgtccgaact cgccggggac      1380
     gccggactgg atccccgcgc cttccggctg ttcctgtccg tgctgggcga cgcactggcg      1440
     gcacgccgtc ccggcatcgc tacgacgacg gccaccagcg gcgacggcac gatggagatc      1500
     cggctgaagc tggtggacgc gggccagatc gtcacgatac cgaccgagga cggcgtcctg      1560
     tccgggccgg agcacgtcgt ggagatcatc gacctgaccg cgcgtccggc ggcggtccga      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page