(data stored in ACNUC7421 zone)

EMBL: CP001700.PE487

CP001700.PE487       Location/Qualifiers
FT   CDS_pept        568223..569434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_5725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69442"
FT                   /db_xref="GOA:C7PX91"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR026367"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69442.1"
FT                   /translation="MPHFFFSYSRKDAPDEYLYRFYDDLCREISVRSHFTIESAGFIDK
FT                   NQPVGGEWEDSIGVALGTCDVFVPVYSPSLFGSSNCGQEWHAFGTRQSRAGKLAPHIVP
FT                   VWWVPTPGELPTIADRIQDTRSQFGAEYQKYGLRYLMQLKENESLYRDFLVKFTMMVLA
FT                   AGENPPELMRDLSLAGAPNAFALKPETTGGRARPRSGLKAGGIKSVRFVVAAGSRDEMR
FT                   TIRAAVDAYGAGSLDWQPYHPEHPDPIVLHAQGVAIAHRMVSSFKAAMDDDLFELLERC
FT                   QASREPVVLIVDPWVVELDAYKDLLARLDTARFGTTAVVVPWESGATIESNLRDILTVH
FT                   LGNWMYAGERFFRDDIRSMGEFEANLGEVLVDMWSRIVKWSDAVRRVDESGPASRPILT
FT                   GPGS"
     gtgccgcatt tcttcttcag ctactcgcgc aaggatgcac ctgatgaata cctctatcgg        60
     ttctacgacg acctgtgtag ggaaatcagc gtccgcagcc atttcaccat cgaatccgcg       120
     gggttcattg acaagaacca gccagtgggc ggtgaatggg aagacagcat cggagtagcg       180
     ctgggaacgt gtgacgtatt tgtacccgtc tattctccga gcttattcgg cagctcgaac       240
     tgcggccagg aatggcacgc gtttggcact cggcagtccc gggctgggaa gctggcgcca       300
     cacatcgtgc ccgtctggtg ggtgccgaca cccggtgagc tgccgacaat cgcggaccgg       360
     atccaagaca cgcgtagtca gttcggcgcg gagtaccaga aatacggact tcgttacctg       420
     atgcagctga aggagaatga gagtctgtac cgcgacttcc tcgtcaagtt cacgatgatg       480
     gtcctagccg ctggcgagaa cccgccggaa ctcatgagag atctgagcct ggccggagcg       540
     ccgaacgcct tcgcgctcaa gccggagacg actggcggcc gggctcgccc gcggtcagga       600
     ctcaaggctg gcggcatcaa gagcgtgagg ttcgtcgtcg ccgcaggtag ccgcgacgag       660
     atgcggacga ttcgggccgc cgtagacgcc tatggcgcag gatcgctgga ctggcagcct       720
     taccatcccg aacaccccga ccccatcgtg ctgcacgcgc agggggtcgc gatagcacat       780
     cgcatggtct cctccttcaa ggcagccatg gacgatgatc tcttcgagct gctggagcgc       840
     tgtcaggcga gtcgggaacc ggtcgtgctg atcgtcgatc cgtgggtcgt agagctcgac       900
     gcctataaag acctgctggc ccgcctcgac accgccaggt tcgggacgac cgccgtcgtc       960
     gtcccctggg agtccggggc gacgatcgag tcgaacctcc gtgacatcct gactgtgcac      1020
     ctgggtaatt ggatgtacgc gggcgagcgg ttcttccggg acgatatccg atcgatgggc      1080
     gaattcgagg caaacctcgg cgaggtgctg gtcgatatgt ggagccgtat cgtcaaatgg      1140
     tcggacgcgg tgcgccgggt cgacgagtcc gggcctgctt cccgtccgat cctgaccgga      1200
     ccgggaagct ga                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page