(data stored in ACNUC7421 zone)

EMBL: CP001700.PE488

CP001700.PE488       Location/Qualifiers
FT   CDS_pept        569440..572580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_5724 ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69443"
FT                   /db_xref="GOA:C7PX92"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69443.1"
FT                   /translation="MKGSIITFYSYKGGTGRSMALANAAWILASNGLRVLVVDWDLEAP
FT                   GLHRYFHPFLSDRDLRTSMGLIDLVWEFVAAALDSEAQDEPGWHEDFARISPYAMSIDF
FT                   DFPGRGTVDLVPAGKQDASYSALVSSFDWGNFYERLGGGGYLEALKRDMRLHYDYVLID
FT                   SRTGLSDTAGICTVHLPDILVNCFSLSTQAIDGAAAVAGSVHRQRENRQVRIFPVPMRV
FT                   EDGEQDKLDASRDFARERFGRFLFHVSDPERYWGEVEVPYKSFYAYEEILATFGDRPQQ
FT                   ENSVLAATERIVGYLSDGQVTALSSSLSESERRVWLTRFQRNGPKLSRTELDVRLPGPP
FT                   LKIFISYAHDSHEHFEEVRELWFLLRANGTDAQLGSPDNERRWNGPVPTATEIRTADLI
FT                   IVAVSPLYRRSTGDDGQTSGDESGAGVEARLIRDEVQGGYSVQRIIPVVLPSAAVTEVP
FT                   AYLADSPVRPVIVEQLTADGIRPLLRQVARFKRVDHKRADFNPSWRENLPKPEPDLEQA
FT                   ALQLARSVASGWEVSAAATLSRPPLATRWSGSQRRGSFDDLVNIFLTSSRGRLLVLGSA
FT                   GSGKTTTAVRLLLDLLARRTDEPIPILLAVATWRPDVEHINTWIIRRLQEDYTVGGIAE
FT                   RLVTTGMILPILDGLDELPVTQRALALDALSTLRINQPFVATCRTGDYRQVAAELGQML
FT                   ANTVVVELEPITSNDIRAYLAVDLPDSDRRWQPVFAHLREFPGGLLAQSMSNPFMLDLM
FT                   RDAYRRPNTDPAELLNNRLFPTTQAIEHRLFGTFIGRAYAPRPSTRPESTYDASSADRW
FT                   LSFLARSLHEQHTRDLSWWHLHRVLPPGGLRTLLALAAGFFGALMLGLAGLRFDVLPDI
FT                   AAIPGWVKGALAGTGLGLFVALVAREPVQLSKPSPRRAEPSPRRRQLGRLVGISADLNQ
FT                   ASSPAAALLIERRTVSTVGLLMVLVIGISELVSGIPRALVEPIVATAVGLIMVRFSTSS
FT                   WGWYSVTRWWLALRGVLPLRVMRFLGDAHARGVLRQQGVAYQFRDVALLEWFAGDHI"
     atgaaaggct ccatcatcac attctattcc tacaagggtg gaaccggccg ctccatggcc        60
     ctggccaacg cggcgtggat cctggcaagc aacggcctga gggtactcgt ggtcgactgg       120
     gaccttgaag cgccgggcct tcaccgctac tttcacccct tcctctccga ccgggatctc       180
     aggacatcga tgggactcat cgatctcgtc tgggagttcg tcgcggccgc cttggactcg       240
     gaagcccagg acgagcccgg ctggcacgag gacttcgctc ggatctcgcc ctatgcaatg       300
     tcgatcgact tcgacttccc cggccgaggt accgtcgacc tggtgccagc gggaaagcag       360
     gacgcgtcgt actcggcgct ggtcagctcc ttcgactggg ggaacttcta tgagcgtctc       420
     ggcggcggcg gctaccttga ggctttgaag cgcgacatgc gtcttcacta cgactacgta       480
     ctcatcgaca gtcgcaccgg tctcagcgac accgccggga tctgcactgt ccacctgcca       540
     gacatcctcg tcaattgctt ctcgctgagc acccaggcca tcgacggcgc cgccgccgtg       600
     gccgggtcgg tgcaccgcca gcgggagaat cggcaggtcc gtatctttcc ggtacccatg       660
     cgcgtcgagg atggagagca ggacaagctg gacgccagcc gggacttcgc ccgcgaacga       720
     ttcggccgct tcctgttcca cgtctccgat cctgaacgct actggggaga ggtcgaggtc       780
     ccgtacaaga gcttttacgc atatgaggag atcctggcca ccttcggtga ccggccgcag       840
     caggagaaca gcgtactggc cgcgaccgag cggattgtcg ggtacttgtc cgacgggcag       900
     gtcacagctt tgagttcatc actctccgag tctgagcggc gggtctggtt gacccgcttc       960
     caacgcaacg gaccgaagct ttcgcgcacc gaactcgacg tccggctccc cgggccgcca      1020
     ctgaaaatct tcatctcgta cgcacacgac tcgcacgagc acttcgaaga ggtccgcgag      1080
     ctgtggttcc tccttcgcgc caatggcacc gacgcccagc ttggctcacc cgataacgag      1140
     cgcaggtgga acgggccggt tccgaccgcg acggagatcc gcacagccga cctgatcatt      1200
     gtcgctgtgt cgccacttta tcgacgatcc accggcgatg acggtcagac atcaggggac      1260
     gagagtggtg ctggagtaga agcacgcctg atccgagacg aggtccaggg cggatactcc      1320
     gtgcaacgga tcatcccggt cgttctcccg tcggccgccg tcacggaggt gccagcctat      1380
     ctagcggaca gcccggtcag gcccgtcatc gtcgagcagc tcacagcgga cggcatccga      1440
     ccgctccttc gccaggtggc tcgcttcaag cgagtcgatc ataagcgggc agacttcaac      1500
     ccctcctggc gtgaaaatct tccgaagccg gaacccgatc tcgaacaagc agcacttcag      1560
     ctcgcccgaa gcgtagccag cggttgggag gtgtcggcgg cggcgacact cagtcgccca      1620
     ccgctggcga cccgatggtc gggaagccag cggcgcggct cgttcgatga tctcgtgaac      1680
     attttcctga cctcttccag aggacggctg ctcgtcctgg gctcagccgg ctcgggtaag      1740
     acgacgacgg cagtccgtct actcctcgac ctgctagcca gaagaacaga cgagccgatt      1800
     ccgatcctgc tggcggtagc cacatggcgg ccggacgttg aacatatcaa cacctggatt      1860
     atccgacgct tgcaggagga ctacactgtc ggcggcatcg ccgagcgtct cgtcacgacg      1920
     gggatgatcc ttccgattct agacgggctc gacgagctgc cggtcaccca gcgtgcgctg      1980
     gcactcgatg cactttctac gctgaggatc aaccagccct tcgtggcaac atgccgaacc      2040
     ggcgattatc gacaggtggc ggccgagttg ggacaaatgc tggcgaacac tgtcgtcgtc      2100
     gaactcgagc caatcaccag caacgacatc cgcgcctacc ttgctgtaga cctgccggat      2160
     agcgatcgtc gttggcagcc ggtattcgcg cacctccgag agtttcccgg tggactacta      2220
     gcacagtcca tgtcgaatcc attcatgttg gacctgatgc gggacgcata tcggaggcca      2280
     aacaccgatc cggccgaact cctaaataac cggctgtttc ccaccacgca agcaatcgag      2340
     catcgtctct tcggcacgtt tatcggcaga gcctatgcgc cgcgtccaag caccagacca      2400
     gaatcgacat acgacgcttc atcggccgac cgctggctta gcttcctcgc gcgctcgctg      2460
     catgagcagc acacgcgaga tttgtcctgg tggcatcttc accgcgtgct gcctccaggg      2520
     ggcctgagga ctctgctcgc gctcgcggcc ggattcttcg gggcccttat gcttggcttg      2580
     gctggcctcc gattcgacgt gttgccggac atcgcagcaa tccccggctg ggtgaaaggc      2640
     gcgctcgccg gcaccggact cgggctattc gttgccctcg tggcgaggga gcctgtacag      2700
     ctcagcaaac catccccccg gcgcgccgaa ccaagtccaa ggcgccgtca gctggggcgt      2760
     ctcgtcggca tttccgctga tctcaaccag gcgtccagcc cagctgcggc actgctcatt      2820
     gaacgcagga cagtatcgac ggtcggactg ctaatggttc tcgtgatcgg catctcagaa      2880
     ctggtatccg gcatcccaag agccttggtc gagccgattg tggcaacggc cgtcggcctg      2940
     attatggtcc gcttcagcac gagctcgtgg gggtggtact cggtgacgcg ctggtggctg      3000
     gcgctccgag gggtactgcc gttgcgagta atgcggttcc tcggcgacgc gcatgctcgt      3060
     ggcgttctgc gccagcaagg agtcgcctac cagttccgcg acgtcgcact cctcgaatgg      3120
     ttcgccggag atcatatatg a                                                3141
//

If you have problems or comments...

PBIL Back to PBIL home page