(data stored in ACNUC7421 zone)

EMBL: CP001700.PE489

CP001700.PE489       Location/Qualifiers
FT   CDS_pept        complement(572571..573023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0494"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_1675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69444"
FT                   /db_xref="GOA:C7PX93"
FT                   /db_xref="InterPro:IPR025325"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69444.1"
FT                   /translation="MATDSGAARQESSYALGLANGSYDWYRQAAIHARQRHRISAIGSQ
FT                   VAAAAIPVSAVIAPHNATVPAILGAVIVVVTSLRSTFNWQENYLRFNGAREAVEAERRR
FT                   YHTTSAPYGDPTSRDQILAAMISKIEQEEMAGWVKVVSERTQTGHI"
     atggccacgg attcgggtgc ggcgcgtcag gagtcgagct atgcgctggg cttggcaaac        60
     ggttcctacg actggtaccg acaagcagcc attcatgcga ggcagcgtca tcggatctcg       120
     gcaatcgggt cgcaggtcgc tgccgccgcc attccagtct ccgcggtgat cgctccgcac       180
     aacgcgaccg tgccggcgat cctgggggcc gtgatcgtgg tcgtgaccag cttgcggtcc       240
     acgttcaact ggcaggagaa ctatctgcgg ttcaacgggg cgcgggaggc cgtcgaggcg       300
     gaacggcgcc gctaccacac gacgtcggct ccctacggtg acccgacgtc gagggaccag       360
     atcctggcag ccatgatctc caagatcgaa caggaggaga tggccggttg ggtcaaggtc       420
     gtttccgagc gcactcagac aggtcatata tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page