(data stored in ACNUC7421 zone)

EMBL: CP001700.PE49

CP001700.PE49        Location/Qualifiers
FT   CDS_pept        complement(49590..49766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ace:Acel_1979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69004"
FT                   /db_xref="GOA:C7QFR5"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR5"
FT                   /inference="similar to AA sequence:KEGG:Acel_1979"
FT                   /protein_id="ACU69004.1"
FT                   /translation="MERARRRLRRDDGMSTVEYTLGTLAACAFAVILYKVITSPMVQEA
FT                   LSGVLRKALNTAF"
     atggaacgcg ccagaagaag actgcgccgc gacgacggca tgtcgaccgt ggagtacacg        60
     ctcgggaccc tcgccgcctg cgccttcgca gtgatcctct acaaggtgat cacgagcccg       120
     atggtgcagg aagccctctc cggagtcctg cgcaaagccc tgaacacggc cttctga          177
//

If you have problems or comments...

PBIL Back to PBIL home page