(data stored in ACNUC7421 zone)

EMBL: CP001700.PE490

CP001700.PE490       Location/Qualifiers
FT   CDS_pept        complement(573548..574078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO2376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69445"
FT                   /db_xref="InterPro:IPR027860"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69445.1"
FT                   /translation="MSTSPGMFGPVSAKGRTGQISFDGRAITITRGGILARGLSGSGTT
FT                   TVPIEQVTGVDFKPTGANHGRITILVAGTVAPRQNSTRSSTDPMTVDFTLHSNDFRRVR
FT                   DAIDTALRNRTAMTTSGWTMPPPPPPPGWAPPTMPAQEPSLADQIGNLARLKEHGHLSE
FT                   EEFAVAKAKLLGL"
     atgagtacgt cgccaggcat gttcggaccg gtctccgcga agggcaggac cgggcaaatc        60
     agcttcgacg gccgggccat cacaatcacg aggggcggca ttctcgctcg gggactcagc       120
     ggaagcggca cgaccacagt cccgatcgag caggtcacgg gcgtggactt caagccgacc       180
     ggagccaacc atggacggat caccatcctg gtcgccggta ccgtagcgcc gcgccagaac       240
     agcacgcgat cttccactga cccgatgacc gttgacttca cactccacag caacgacttc       300
     cggcgggtgc gcgacgcgat cgacaccgct ctacgcaacc gtacggctat gacgacttcc       360
     ggctggacca tgccgccccc tcctccgccg cctgggtggg ctccgccgac catgccagcg       420
     caagagccct ccctcgccga ccaaatcgga aacctcgcac ggcttaagga gcacggccat       480
     ctcagcgagg aggagttcgc ggtggcaaaa gcgaagctgc tcgggcttta g                531
//

If you have problems or comments...

PBIL Back to PBIL home page