(data stored in ACNUC7421 zone)

EMBL: CP001700.PE491

CP001700.PE491       Location/Qualifiers
FT   CDS_pept        574640..575116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0496"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   sma:SAV_2480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69446"
FT                   /db_xref="GOA:C7PX95"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX95"
FT                   /inference="protein motif:PFAM:PF03819"
FT                   /protein_id="ACU69446.1"
FT                   /translation="MTVESGIREAGRLCVEPGLSDAMRAVAAFHTAFDLPRQPVPSTDV
FT                   STELAQLRVDLLVEEVGEFADATSKRDLTAMADALGDIIYVAYGAAVTYGIDLDAVLME
FT                   IHRSNMSKLGSDGRPVLRQDGKVLKSSSYRPPDVARVLAEQSELTVVSEAIDHP"
     atgacggtag agagtggcat ccgagaagcg gggcggctct gtgtcgagcc tgggcttagc        60
     gatgcgatgc gagctgtcgc ggcgttccat acagcgtttg accttccccg acagccagta       120
     ccctctacag atgtgagtac ggagctggcc cagctgcgtg tggacctcct tgtcgaggag       180
     gtgggtgagt tcgccgatgc aactagcaag cgtgatctca ccgccatggc agacgcgttg       240
     ggcgacatca tctacgttgc ctatggtgcg gcggttacct acgggattga tcttgatgct       300
     gtgcttatgg agatccatcg ttccaacatg agcaagcttg ggtctgacgg acgtcccgtg       360
     ctccggcaag atggcaaggt gttgaaatca tcaagctatc gccccccgga tgttgctcgc       420
     gtactggccg agcagtcaga acttacggtg gtcagcgagg cgattgatca cccatag          477
//

If you have problems or comments...

PBIL Back to PBIL home page