(data stored in ACNUC7421 zone)

EMBL: CP001700.PE492

CP001700.PE492       Location/Qualifiers
FT   CDS_pept        575177..576604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0497"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; SMART:
FT                   Appr-1-p processing domain protein; KEGG: sus:Acid_6274
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69447"
FT                   /db_xref="GOA:C7PX96"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR031053"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX96"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ACU69447.1"
FT                   /translation="MAAEGAITESSSWTNTSVLLFVGDDDPLAAVTALAKKIINEAEDC
FT                   GLQGPPFDPFALAELLGLSLRARADIADAHISADTIGVRSTPDAPLGHFVQAKRSLAIE
FT                   YNPTRPRGRLRYSVAHEIAHALFPDVADVVRHRTGSGGVAGYGGDDSWQLELLCNVVAA
FT                   ELLMPDQAVAGLIDIDPDIDFIMEYRRRFDVSTEALLRRLVGLTGRGLALVAASRSQDD
FT                   ASASLIVEYVVGSAQFSPRVHRGATVSSAGAFGKCVAVSQTARGVETLETVPLRVQAVG
FT                   VPPYPGFSLPRVLALVEPVVPIGKESGGLRYRSGDVTNFSAGDRPVVIAHVVNDSAHAW
FT                   SRRGVAAALSTRFPAAARAFQAWTVAAPTNLELGRVHAVDVTTGQSLVTIASMVVQRGY
FT                   GAGFSTRLDYQALDTALAAVAKFALTKGADVHLPRIGAGQAGGRWDLIAQAIERNLVGA
FT                   GLEVVVYTLPQRPRGKT"
     atggccgccg aaggagcgat caccgagagc tcatcgtgga ctaacacttc cgttttgctg        60
     tttgtcggcg atgatgaccc gttggcggca gtcactgctc tcgccaagaa gatcataaac       120
     gaggccgaag actgtgggct tcaggggccg ccgtttgatc cttttgccct cgccgagttg       180
     cttgggctgt cgctgcgagc gcgggctgac atagcagacg ctcatatcag tgcagacacc       240
     attggggtca gatcgactcc agacgccccg ctagggcact ttgtccaggc caagcggtca       300
     ctggcaatcg aatacaaccc gacgcggcca cgaggccgcc ttcgctacag cgttgctcac       360
     gagatcgccc atgcactgtt tcccgacgtc gcggacgtag tgcggcatcg tacggggagc       420
     ggtggtgtgg cggggtacgg cggtgacgac tcttggcagc ttgagctgtt gtgcaacgtc       480
     gtggccgctg agctgttgat gccggaccaa gcagttgccg gactcattga tatcgatccc       540
     gatatcgact tcatcatgga gtaccgacgg cgctttgacg tttccaccga agcgctgctg       600
     cgaaggcttg tcggtctgac gggacggggc ctggcactcg ttgcagcctc acgctcgcag       660
     gacgacgcta gcgcatccct gatcgtcgag tacgtggtcg gatcggctca gttctccccg       720
     cgtgtgcacc gaggcgccac agtgtcctcg gctggtgcgt tcggaaaatg cgttgccgtg       780
     agccagactg cccggggtgt ggagacactt gagacggtgc ctttgcgggt gcaagccgtc       840
     ggtgtaccgc cgtatcccgg cttctcccta ccgcgcgtgc tcgcgctcgt tgagccggtc       900
     gtccccatcg gcaaggagtc gggtggactg cgttatcgaa gcggtgatgt caccaacttc       960
     tctgcgggtg acaggccagt cgtgatcgct catgtcgtaa acgactcggc gcatgcgtgg      1020
     agtcgccgcg gtgtcgcggc tgcgctttcg acacgtttcc cggccgcagc gcgtgccttt      1080
     caagcgtgga cggtagcagc gccgacgaat ttggagctgg gtcgcgtaca cgctgttgac      1140
     gtcacgaccg gtcagagcct ggtcacgatc gcgagcatgg tggtgcagcg cgggtacgga      1200
     gcgggattct caactcggct ggactaccaa gcgttggata ctgcgcttgc cgctgtcgca      1260
     aagttcgcgc tcacaaaagg tgcagacgtc cacttgcccc gaatcggagc tgggcaggca      1320
     ggggggcgct gggacctgat tgcacaggcg attgagcgca acttggttgg tgccggcctg      1380
     gaggttgttg tctacaccct gcctcagcgc ccgcggggaa agacttag                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page