(data stored in ACNUC7421 zone)

EMBL: CP001700.PE493

CP001700.PE493       Location/Qualifiers
FT   CDS_pept        576658..578310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0498"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: sus:Acid_6275 adenylosuccinate synthetase;
FT                   PFAM: adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69448"
FT                   /db_xref="GOA:C7PX97"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX97"
FT                   /inference="protein motif:PRIAM:6.3.4.4"
FT                   /protein_id="ACU69448.1"
FT                   /translation="MKTRPRLVVISGPVGSGKSTLARRLVSRYGAFDIRTQDLMRAHAV
FT                   AYDKELPLERRALQEYGEQLDIDTGGGWVAEGVAKLLDQRDEPIDGHGLIVVDSVRAHH
FT                   QVERLREAYGARVTHIHLNAPESVLGERYAERGDASGLVELDSYTEVAQNKTESAVGQL
FT                   ESEADITIDTQRNLPGDVETRAAAALGLYASRTDKLVDVLIGAQYGSEGKGNIAFYLAP
FT                   EYDVLVRVGGPNAGHKVPLPTPYTHRLLPSGSRANLAACIVIGPGATLSLEVLMREIAE
FT                   SGVEVDRLSIDPQCMIIENADLDAEAQLVGKIGSTGKGGGAAAARRIMGRHYDEASETP
FT                   VRLARDVQELVPYVRPTGEILDDAFARGHRVLLEGTQGTGLSLYHGSYPHVTSRDTTTA
FT                   GTLAEAGIGIHRVRRVIIVARTYPIRVKNPDEGTSGPMSQELSWEEIARRSGIPEEELV
FT                   KQEKGSVSNNQRRVAEFDWQMLRRASEINGATDVALTFTDYLDIGNRDARRYEQLSPKT
FT                   IDFIEEVERVAGVPVSLLGTRFDIRSVIDRRQW"
     atgaagactc gcccacgttt ggtagtgatc agcggaccag tcgggtcagg taaatcaaca        60
     cttgcccgac gtctggtcag caggtatgga gcgttcgaca tccggacgca agaccttatg       120
     cgcgcgcatg ctgttgcata cgacaaagaa ctgccgctgg agcgtagggc gcttcaggaa       180
     tacggtgaac aactcgatat tgacacaggc gggggttggg tcgcggaagg ggttgccaag       240
     ctcctagacc agcgcgatga accaatcgat ggtcacggtc tcattgtcgt cgattcggta       300
     cgggcccatc atcaggtcga gcgtcttcga gaggcatacg gcgcgcgagt gactcacatc       360
     catctcaacg cgccggaatc ggtactgggt gagcggtatg ccgaacgtgg tgacgcgagt       420
     ggtctcgtcg agttggattc gtacaccgag gttgcgcaaa ataagactga gtctgctgta       480
     ggtcagctcg aatccgaggc tgatattact attgacacac aacgcaactt gccgggcgat       540
     gttgaaacga gggcggctgc tgcgctgggg ctgtacgcgt cgcgaacgga caagcttgtt       600
     gatgtcctca taggggccca gtacggaagc gaaggtaagg gaaacatcgc tttctatcta       660
     gcacccgagt acgacgtcct tgttcgtgtg ggtggcccga acgctggtca caaggtgccg       720
     ttaccgactc cgtataccca tcggctactg ccgtcgggtt cacgtgccaa cctcgctgca       780
     tgcatcgtga tcggccccgg cgcaactttg tcgcttgagg tgctcatgcg tgagattgct       840
     gaatccggtg tcgaagtcga ccgactctcg atcgaccctc aatgcatgat catcgaaaac       900
     gccgatctgg atgccgaggc tcaactagtc ggcaaaatcg gctcgaccgg caagggtggc       960
     ggggcggcgg ctgcgcgacg catcatgggg cgtcattacg acgaagcttc ggagactccg      1020
     gttcgtctcg cacgtgatgt acaagaactc gtaccctatg tccgtccaac tggcgagata      1080
     ctcgacgatg cgttcgcgcg gggtcatcgt gtactgctcg aggggacgca aggtactggg      1140
     ttgagcctgt atcacggcag ctacccacac gtgaccagcc gcgacacaac tacggcggga      1200
     accctcgcgg aggcgggaat cggtatccat cgggttcggc gcgtgatcat tgtcgcacgc      1260
     acctatccga tccgtgtcaa gaacccagac gagggcacat caggacctat gtcccaagag      1320
     cttagctggg aagagatcgc acgacgttca ggcatcccag aagaagaact tgtcaaacaa      1380
     gaaaagggtt cagtcagtaa taaccagcgt cgcgtcgccg agtttgactg gcagatgttg      1440
     cgccgcgcat ccgagatcaa cggcgctacc gacgtcgcgc tgactttcac agattacctc      1500
     gacatcggca accgtgacgc gcggcggtac gaacaactta gcccgaaaac gatcgacttc      1560
     atcgaagagg ttgagagggt cgccggcgtg ccggtttcac tgctagggac ccgtttcgat      1620
     atacgaagtg tcatcgatcg acggcaatgg taa                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page