(data stored in ACNUC7421 zone)

EMBL: CP001700.PE494

CP001700.PE494       Location/Qualifiers
FT   CDS_pept        578304..579032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69449"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX98"
FT                   /inference="similar to AA sequence:KEGG:Acid_6276"
FT                   /protein_id="ACU69449.1"
FT                   /translation="MVSTAWAFTTMTSERRLSNVQRDELINKYPVLYHMAEEGTWPSIQ
FT                   KRGLLSTQALVDLYNPEPAVKNSILGAVRRSSIALDNPVLGRTIIRDQRPLKFLDKCLL
FT                   PGTSPQQFLDVLNGRVFFWLARHRLETLLSARLYRDKQQTVLHVDTGRLMERYGDEVEL
FT                   APYNTGSMHIPNAPRRGKDVFVAVDDYPYDDWRVQRGSKGDAVVELTVPYAVPDISDMT
FT                   LRVESWSGGDVVDVIYSAPD"
     atggtaagta cggcatgggc gttcaccacg atgacttctg agaggcggct gtcgaacgtg        60
     caaagagatg agctcattaa caagtaccca gtgctatacc atatggcaga agaaggtact       120
     tggccttcaa ttcaaaagcg cggcctgctt agcactcagg ccttagttga tctctataat       180
     cccgaaccgg ctgtaaagaa ttcgatacta ggggcggtaa ggcgtagcag catcgcactg       240
     gacaatccag ttctcggtcg cacaattatc cgagaccaaa ggcctctgaa attcctggac       300
     aaatgtctac ttcccggtac ctcgccacaa cagttccttg acgtactcaa cggcagggtg       360
     tttttctggc ttgcccggca ccgtcttgag acgctgctgt cagccagact ctaccgtgac       420
     aagcaacaga ctgtcctgca cgtggatacg gggcgactta tggagcgata cggtgatgaa       480
     gtcgaacttg cgccctataa cacggggagc atgcatatac cgaacgcgcc tcggcgcggg       540
     aaggacgttt tcgttgccgt cgacgactat ccgtatgatg attggcgcgt ccaacgtgga       600
     agcaagggcg atgcggttgt tgaacttact gttccctatg ccgtaccgga tatcagtgat       660
     atgacgcttc gtgtagaaag ttggagtggt ggcgatgttg tagatgtaat ctactcggca       720
     ccagattag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page