(data stored in ACNUC7421 zone)

EMBL: CP001700.PE495

CP001700.PE495       Location/Qualifiers
FT   CDS_pept        complement(579523..580476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_3293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69450"
FT                   /db_xref="UniProtKB/TrEMBL:C7PX99"
FT                   /inference="similar to AA sequence:KEGG:SGR_3293"
FT                   /protein_id="ACU69450.1"
FT                   /translation="MKMVAWLAQHARPGVSWDRLALQAFDEDMPVPSEGIRRAFTRQID
FT                   KTRLPGGIALDSAPGTDRETWAVEAAETVTATGATMFRPLARIARIDSAVQSLLAAHAP
FT                   WPPQEYADLDRRTDTDRTPAEITQMAVAAIIDPENYLPGSTIADVLAALLPEGQLSPMA
FT                   SFLEFSDLDATELTAAEWLGKNMAGSILEELRAAIAAADIAELRQAYRAAQACTRRTGE
FT                   LLNSVEAEIGAGTLGDACRAWVSAAAFGLPRIMLLVTARDRKPHEFAISAALLLWTNRM
FT                   VSRLRSAFPGGFTALDEPLRQMVEGLSLAVLTGEDA"
     atgaagatgg tcgcctggct ggcccagcac gcccgccccg gtgtttcctg ggaccggctc        60
     gcgctgcagg ccttcgacga agacatgccc gtaccctcgg aaggaattcg cagggctttt       120
     acgcggcaga tcgataagac ccggctaccc ggaggcattg cgctcgactc cgcaccgggt       180
     accgaccgag agacctgggc cgtggaagca gcggaaaccg tgactgctac gggcgcgacc       240
     atgttccgtc cactggccag gatcgccagg atcgacagcg ccgttcagag cctgcttgcc       300
     gcgcacgccc cgtggccgcc tcaggaatac gctgatcttg accgccgtac ggataccgac       360
     cgaaccccgg cagagatcac gcagatggcc gttgcggcga tcatcgatcc ggagaactac       420
     ctaccgggat cgacgatcgc cgatgttctg gccgcgctgc tgcctgaagg ccagctcagc       480
     ccgatggcct cgttccttga gttcagcgac ctggacgcca ctgagctgac agccgcggag       540
     tggctcggca agaacatggc tgggtccatc ctcgaagagc ttcgcgcggc tattgctgca       600
     gcggacatcg cagagcttcg ccaggcatac cgtgcagcgc aggcatgtac ccgccgcacc       660
     ggcgaactgc tgaactctgt ggaggcagag atcggcgcgg gcacgctcgg ggacgcgtgc       720
     cgcgcgtggg tttcggccgc ggccttcggg ctccctcgga tcatgttgtt ggtgacggca       780
     cgggaccgta agccccacga gttcgcgata tcggccgcgc ttctgctgtg gaccaatcgg       840
     atggtcagtc gtctacgctc cgctttcccc gggggtttca cggccctgga cgaacctctg       900
     cggcagatgg ttgagggcct ttcacttgca gtgctcaccg gcgaggatgc ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page