(data stored in ACNUC7421 zone)

EMBL: CP001700.PE496

CP001700.PE496       Location/Qualifiers
FT   CDS_pept        complement(581927..582034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69451"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69451.1"
FT                   /translation="MLLSPLARYLVVAGVDAAATTVTVKGVDYFFDLAQ"
     atgctgctgt cgcccctcgc ccgctacctg gtggtcgccg gagtcgacgc cgctgcgacc        60
     accgtgaccg tcaaaggcgt ggactacttc ttcgacctgg ctcagtga                    108
//

If you have problems or comments...

PBIL Back to PBIL home page