(data stored in ACNUC7421 zone)

EMBL: CP001700.PE497

CP001700.PE497       Location/Qualifiers
FT   CDS_pept        complement(582089..586327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0505"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; PKD domain containing protein; SMART:
FT                   PKD domain containing protein; Parallel beta- helix repeat;
FT                   KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69452"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA1"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69452.1"
FT                   /translation="MRARRVTLAALSALGVSVGVASAPAHAAAPTTIYVDNGSAACSDT
FT                   GSGTQDQPFCTINAAAKSAAPDDTVLIEPGTGHYSEPMMNIQTSGTPGHPITYQAAQGT
FT                   FTMGNVNSPGQYDAAYGLRFDQTVHDIVIQGFHFGGGLWVDEESARFQVRNNFFDGSGL
FT                   AMYDGEAMEVTGNTFTNAPLSVEGAMGGISEPTPTLVDHNTVVGGSIWADMGSTTVTHN
FT                   TVSGSSTFGILAGTNKSSSMWDAQVTIAGNLVYGNAGGGISAANWGATITGNTIADNGG
FT                   NQVEIHSPTPIPYTPPSPPQTHVENNIIATGTTLPHSAAATASQIGITVDQAAWATTFV
FT                   DRNVVSLAQGRPYEIGTTIVPDGAHLAALGHGGTAEINAAPLLNADGTLRAGSPAVDSA
FT                   DSAAAGEQATDLAGNTRHDDSGVCDTGAGSRSYDDRGAFEFQGTTSPAVACAAPTAPVP
FT                   AAPAPTVDSVDFPATGGYFGVGRAGYFHVADHSGARNPIQFSVDGGVAQQLLADASGSL
FT                   MIPYTATTAGPHWIDVQVVGASPSLTTRYTFTVPATDTVVAPTAYFTVAGDRANPKSVT
FT                   VNAIKSLHGTTPIQSFTYHFGDGTSTGPTSATSATHIYSTADKFPITVTVQDTDSLSNS
FT                   MQATYDASTGQTSTPKPSPNTIHVNNAAGANCSDAAGSGSASKPFCTIAAAAALTNPGD
FT                   TVLVSAGTYASGVDITRSGTPGDPITYTTSGTVDLVSPSNAAYMGTAFTLSGVHDVTVH
FT                   GFVMDTKGSNGVLVGNSQNVEISGNTINDDGVFGASTYEGVQFTNVTDSAIVDNTVNAG
FT                   DIQGIVVDSGSLRAAIQGNTVRATRNVVYYTMIQDAAPNSTVVGNRVSNPESRDIAISS
FT                   GADGTVVAGNMATCSNVGISVDANNVAVTANTVMQTAGRELAVGGNGNVTGTSIRDNVF
FT                   AIPDNTFDCGSPNDGSIGMYGVDIYAGSTAGTTLDHNDVWFPLYGPGYQWGDTEYAVTT
FT                   PAQLAAFTTATGQSAHDTVAWPMLDANGAPRPGSPTIDAADSSATGYPDKDLLGNPRVD
FT                   DSTTPNTGLGPIAYGDMGAVEYQPQAPGGGTPTPTPTPTPPPTPTPAPVPNPGTGQPTV
FT                   QRLGGGTRYATGLMVSQHQWAAGKASAVVLARGDAAPDALAGVPFAAHVHGPLLLTDPS
FT                   ALDSETRSEIDRVLGGPHSGKTVYILGGAGAVAPSIEKGLRDAGYKVVRYGGDSRFSTA
FT                   LQIASAFGPTDHVIVATGRNFPDALSAGSLGAAEGAPIVLSDDTVLDAATAAFVARHPA
FT                   IDPVGVQAQHAVAGLAAGRTVDRSLAGSDRYVTATDVATRVAQILGHTPATVGVASGTA
FT                   FPDALTGGAFIANAGGALVLTDPTRLTASTGALLTGWHGGLSTIEVFGGPLAVSGPTYD
FT                   AIVKTVGARS"
     atgcgcgcgc gtcgcgtcac actcgctgct ctttctgcgt tgggcgtgtc cgtgggggtg        60
     gcttccgcgc cggcgcacgc ggccgccccg acgaccatct atgtcgacaa cggtagcgcc       120
     gcctgctccg acaccgggtc cggaacgcag gatcagccgt tctgcacgat caacgccgcc       180
     gcgaagagcg cggcgcctga cgacaccgtg ctgatcgagc cggggacggg gcactactcc       240
     gagccgatga tgaacatcca gacttccggc acgcctggtc atcccatcac ctaccaggca       300
     gcgcagggta cgttcacgat gggcaacgtg aactcgcccg gccaatacga cgccgcgtac       360
     gggctgcgat tcgaccagac cgtgcacgac atcgtcatcc agggtttcca cttcggcggc       420
     ggtctctggg tcgacgagga gtcggcgcgg ttccaggtaa ggaacaactt cttcgacggg       480
     tccggcctgg ccatgtacga cggagaggcg atggaggtga caggtaacac cttcacgaac       540
     gcccccctgt cggtggaggg cgcaatgggc ggcatctccg agccgacgcc cacgctcgtc       600
     gaccacaaca ccgttgtcgg cggcagcatc tgggccgaca tgggcagcac aaccgtcacc       660
     cacaacacgg tgtcgggaag ctccaccttc gggatcctcg ccggcaccaa caagagttcc       720
     tcgatgtggg acgcgcaagt gaccatcgcc ggaaacctgg tctacggcaa cgccggcggc       780
     gggatctcgg cagcgaactg gggtgccacc atcaccggca acaccatcgc cgacaacggc       840
     ggcaaccagg tcgagatcca ttcaccgacg ccgatcccgt acacgccgcc gtcgccgccg       900
     cagacccatg tcgagaacaa catcatcgcc accgggacca cgttgccgca cagcgcggcc       960
     gccacggcgt cccaaatcgg gatcacggtc gatcaggccg cctgggccac gaccttcgtc      1020
     gaccgcaatg tggtgagcct ggcacagggc cggccttacg agatcgggac gacgatcgtc      1080
     ccagacggtg cccacctggc ggcgctcggg cacggcggta cggccgagat caacgcggcc      1140
     ccgctgctca acgcggacgg caccttgcgg gcgggatcgc ccgccgtcga ctcggcagac      1200
     tcggctgcgg ccggggagca ggccaccgac ctggccggca acacccggca cgacgactcc      1260
     ggggtctgcg acaccggagc cggatcccgt agctacgacg accgcggcgc cttcgagttc      1320
     cagggaacga ccagccccgc tgtggcctgt gcggcaccga ccgcacccgt ccccgcggcc      1380
     ccggctccga ccgtcgactc ggtcgacttc ccggcgaccg gtggctactt cggggtcggg      1440
     cgcgccggat acttccacgt cgccgaccac agcggcgcgc gcaaccccat ccagttctcg      1500
     gtcgacggcg gcgtggcgca gcaactcctc gccgatgcct cggggtcgct gatgattccc      1560
     tacaccgcga ccaccgcggg gccgcactgg atcgacgtcc aggtcgtcgg tgcgagcccg      1620
     tcgttgacaa cccgctacac cttcaccgtc ccggccacgg acacggtcgt cgcgccgacc      1680
     gcgtatttca cggtggctgg cgaccgggcg aatcccaagt cggtgaccgt caacgcgatc      1740
     aagtcgctgc acggcaccac accgatccaa tcattcacgt accacttcgg tgacggcacc      1800
     tccaccggac cgacgagcgc cacgagcgcc acgcacatct acagcaccgc ggacaagttc      1860
     ccgatcacgg tcacggtcca ggacaccgac agcctgtcga actcgatgca ggcgacctac      1920
     gatgcgagta ccggtcagac ttcgacgcct aagccgtctc ccaacacgat ccacgtgaac      1980
     aacgccgccg gagccaactg ctcggacgcg gctggctcgg gcagcgccag caagccgttc      2040
     tgcactatcg cggcggccgc ggcgctcacc aaccccggcg acacggttct ggtgtcggcg      2100
     gggacctatg cgtcgggggt ggacatcacc cgctccggca cgcctgggga cccgatcact      2160
     tacacgacct caggcaccgt agatctggta tcgccctcta atgccgccta tatgggcacg      2220
     gcgttcacgc tcagtggcgt ccacgatgtg accgtccatg gattcgtcat ggacacgaag      2280
     ggctccaacg gtgttctggt cggcaactcg cagaacgtcg agatctccgg gaacacgatc      2340
     aacgacgacg gcgtgttcgg cgcttccacc tacgagggcg tccagttcac gaacgtcacc      2400
     gacagcgcca tcgtcgacaa caccgtgaac gccggcgaca tccaaggcat cgtcgtggat      2460
     tccggctcgc tccgggcggc tatccaaggg aacaccgtcc gtgccaccag gaacgtcgtc      2520
     tactacacga tgatccagga cgccgcgccg aacagcaccg tcgtcggcaa ccgggtctcg      2580
     aacccggagt cccgcgacat cgcgatcagc tccggcgccg acggcaccgt ggtggccggg      2640
     aacatggcga cctgcagcaa cgtgggcatc agtgtcgatg cgaacaatgt cgcggtcacc      2700
     gccaacaccg tgatgcagac cgcgggccgg gaactcgccg tcggcgggaa cgggaatgtg      2760
     accgggacgt cgattcgtga caacgttttc gcgatcccgg acaacacctt cgactgcgga      2820
     tcgcctaacg acggcagtat cggcatgtac ggcgtcgaca tctacgcggg ctcgaccgcc      2880
     gggacgacgc tcgaccacaa tgacgtctgg tttccgttgt atggacccgg atatcagtgg      2940
     ggcgataccg aatatgccgt gacgaccccg gcccaactcg cagccttcac caccgccacg      3000
     ggccagagcg cgcacgacac cgtggcctgg ccgatgctcg atgcgaacgg cgctcccagg      3060
     cccggcagtc cgacgatcga cgcagcggac tcgtccgcga ccggctatcc ggacaaggac      3120
     cttctgggca acccccgcgt cgatgactcc acgaccccga acaccggcct cggcccgatc      3180
     gcctacggag atatgggtgc cgtcgaatac cagccgcagg ctcccggcgg tggtaccccg      3240
     actcccacgc ccacgcccac accgccgccg acccccaccc ccgcaccggt tccgaacccc      3300
     ggtaccggcc agcccacggt gcagcggctc ggcggcggca cgcgttacgc aaccggtctg      3360
     atggtctccc agcaccagtg ggccgcgggc aaggcaagcg cagtcgtgct ggcgcgtggt      3420
     gatgccgcgc ccgacgcgct cgccggcgtg ccgttcgccg cgcacgtcca cggcccgttg      3480
     ctgctcaccg atccgtcggc gctggactcc gagacccgca gcgagatcga ccgggtcctc      3540
     ggtggtccgc actccggcaa gactgtctac atcctcggcg gagctggtgc ggtggcgccc      3600
     tcgatcgaga agggtctgcg cgacgccgga tacaaagtcg tccgttacgg cggtgacagt      3660
     cgcttctcca cggcgttgca gatcgcttcg gccttcgggc ccaccgatca cgtcatcgtc      3720
     gccaccgggc gcaacttccc ggacgcgctg tcggcggggt ctttgggcgc cgcggagggc      3780
     gcgccgatcg tcctgtccga cgacacggtc ctcgacgcag ccactgctgc gttcgtcgcg      3840
     cggcacccgg cgatcgaccc ggtcggcgtc caggcccagc acgcagtggc cggcctcgcc      3900
     gcagggcgaa cggtcgaccg cagcctggcc ggctccgatc gctacgtcac cgcgaccgac      3960
     gtcgcgaccc gtgtcgccca gatcctgggc cacactccgg cgacggtcgg cgtcgcatcc      4020
     ggcaccgctt tcccggatgc cctcaccgga ggcgccttca tcgccaacgc tggcggcgcg      4080
     ctcgtgctga ccgacccgac caggctgacg gcctccaccg gcgctctcct cacaggctgg      4140
     cacggcgggc tgtccacgat cgaggttttc ggcggcccgc tggccgtgtc cgggcctacg      4200
     tacgacgcga ttgtcaaaac agtcggggct cggtcctga                             4239
//

If you have problems or comments...

PBIL Back to PBIL home page