(data stored in ACNUC7421 zone)

EMBL: CP001700.PE498

CP001700.PE498       Location/Qualifiers
FT   CDS_pept        586579..587925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0506"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; SMART: PKD domain containing protein;
FT                   KEGG: ace:Acel_1461 cell wall binding repeat 2- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69453"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA2"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69453.1"
FT                   /translation="MSRSIGFGLALVAVLGTGLGPIAPVHADPAASPAKLSHVSPLFQP
FT                   SLTVTAQNDHGLIAVTMPAAGGQYSLSMGDGTTLRGADNQPEIYYTYQASGRYLVQLAD
FT                   TDAGGSTGTAAVWVDVTVATAPPLAHAVARISGGDRYATAIAVSRTAWTGGSAKAVVLA
FT                   RGDKYPDALSGVPLAAHVGGPLLLTDPTVLDTATRAEIDRVLGGPASGRTVYILGGTAA
FT                   ISPGVEKGLVSAGYHVVRYSGADRAGTALAVAQQAFTSAPGALIATDTDFADALAAGPL
FT                   AAALGEPILLTGQWTISDGAWNWLQQHPRVGTVGEPALAVISERAMHGWGNIRANDGFQ
FT                   GPDRYTTALAVAHAMIDQTSGSLPPGRSTGVCFASGETFPDALSGGALCALQNRPMLLL
FT                   PATGGEGDVLAALDHWNGALSQAELFGGPAALSQTAEDQVAQALSFTEN"
     atgagtcgtt ccattggctt cggccttgcg ctcgtcgccg tgctcggcac tggtctgggg        60
     ccgatcgctc cggtgcatgc ggatcccgcc gcgtcacccg cgaagctgtc gcatgtaagc       120
     cctctgttcc agccctctct gacggtcaca gcgcagaacg accacggcct gatcgctgtc       180
     acgatgcccg cagccggcgg ccaatactcg ctgtccatgg gcgacggcac cacgttgcgc       240
     ggcgccgaca accagcccga gatctattac acctaccagg cgagcggccg gtatctggtt       300
     cagctggccg acaccgacgc cggggggtcg acgggtacgg ccgccgtctg ggtggacgtg       360
     actgtcgcga ccgcaccgcc gctggctcac gccgtggccc ggatttccgg aggggaccgc       420
     tacgcgaccg cgatcgcggt gtcgcggacg gcgtggaccg gcggctcggc caaggccgtg       480
     gtgctggccc ggggtgataa gtaccctgac gcactgtccg gcgtcccgct ggccgcccat       540
     gtcggcggtc cgctgctgct gaccgatccc acggtgctgg acaccgcgac ccgcgccgag       600
     atcgaccgcg tcctcggggg cccggcgtcc ggccggacgg tatacatcct cggaggcacg       660
     gcggcgattt cgccgggggt ggaaaaaggt ctggtctctg ccggctatca cgtcgtccgc       720
     tactccggcg cggaccgggc cggaaccgct ctggccgtcg cgcagcaggc tttcacctcc       780
     gcgcccggcg ccttgatcgc caccgacacc gacttcgccg acgcgctggc ggccggcccg       840
     ctggcggcgg cactcggcga accgatcctg ctcaccggcc agtggacgat cagcgacggt       900
     gcctggaact ggctccagca gcatccgcgg gtcgggacgg tcggcgaacc ggccctcgcg       960
     gtgatcagcg agcgcgccat gcacggttgg ggcaacatcc gcgccaacga cggcttccag      1020
     ggtccggacc gctacaccac cgcgctcgcc gtcgcgcacg ccatgatcga ccagacatcc      1080
     ggctcgctgc cgccgggccg gtccaccggg gtgtgcttcg cctcgggcga gacctttccc      1140
     gatgccctgt cgggcggcgc gctttgcgct ctgcagaaca ggccgatgct gttgcttccg      1200
     gcgaccggcg gcgagggcga tgtgctggct gccctggacc actggaacgg cgcgctttcc      1260
     caggccgaac tgttcggcgg cccggcggcg ctgtcgcaga ccgccgaaga ccaggtcgcg      1320
     caagcgctca gcttcactga aaactga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page