(data stored in ACNUC7421 zone)

EMBL: CP001700.PE499

CP001700.PE499       Location/Qualifiers
FT   CDS_pept        587952..589754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0507"
FT                   /product="putative cell wall binding repeat 2-containing
FT                   protein"
FT                   /note="PFAM: putative cell wall binding repeat 2-
FT                   containing protein; KEGG: ace:Acel_1679 protease-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69454"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA3"
FT                   /inference="protein motif:PFAM:PF04122"
FT                   /protein_id="ACU69454.1"
FT                   /translation="MTRIRLAAPLILSSAALISALMPPLTASAAGTASTPCAPAPVTGT
FT                   PTGPLTAAVQSDDFPSLSGGLPPTHGPNQPGVFHLSGSGGVSPIVCFQYSVPETGVSNA
FT                   TISADASGRANLTLALPYAGLASVTVSAVDAAGNVSAPVTYSFNVLSAVPTKLSAQIEI
FT                   GGSSDGTVTGVVTASGPNPVLNYHVDFGDGTTVNQASPAFRHVYRSTWWYQIVVTVTDS
FT                   SGATTTATALNVRTTVPSTMQRVSGTTRYDTSTAVSRRLWADAADDQTDRLAAHTVVLA
FT                   SGATFPDALAGIPLASYKQGPLLLTEPQQLTDTTRQEIHRVLPKGGTVYVLGGQNAVSP
FT                   DVAATLSGDGYHVIRYGGKTRYETALIIAKQGLDNPAHVVIATGTDYPDALAAGPAATG
FT                   RLSSGGKPAAILLSDGATFNDAATAAYIRSKLVRYQTGMPNVTAIGWSSTLAGLAMIGV
FT                   PDYIIDSTIKPGTPAKSGGDSWGTDIGTLYFIAGADRYTTAEGVAIEDTGPDCCAPDDP
FT                   FVGYASGNGFADALTGGAALATLHGRLFLTAPNYVPTATTAIFPGPPDQVKGTTYTGTV
FT                   FGGTQAVSQGVEDRLAQVLEAKEQ"
     atgacccgca tccgtctggc cgctccgctg atcttgagtt cggccgcatt aatcagcgct        60
     ctgatgccgc cgctgaccgc ctccgccgcc gggaccgcgt cgacgccctg cgcccccgcg       120
     ccggtcaccg gcacgcccac cggcccgctg accgccgcgg tgcaatccga cgacttcccg       180
     tcgctttccg gcggcctgcc cccgacgcac ggcccgaacc agccgggcgt cttccacctg       240
     tccggctccg gcggggtctc gccgatcgtg tgcttccagt acagcgtccc ggagaccggc       300
     gtcagcaacg ccacgatcag cgccgacgcc tccggccgcg ccaacctgac attggcgctg       360
     ccgtatgcgg gcctggcgtc ggtcacggtc agcgccgtcg acgcggccgg gaacgtctcg       420
     gcaccggtga cctactcgtt caacgtcctg tccgcggtcc cgacgaaatt gtccgcgcag       480
     atcgagatcg gcggatcgtc cgacggcacg gtcaccgggg tggtcaccgc ctccggtccg       540
     aatccggtcc tgaactatca cgtcgacttc ggcgacggga ccacggtcaa ccaggcctcg       600
     ccggccttcc gacacgtcta ccgctccacc tggtggtacc agatcgtggt cacggtgacc       660
     gactcctcgg gagcgacgac caccgccacg gcgctcaacg tccgcacgac ggttccgagc       720
     acgatgcagc gggtctccgg gaccacccgc tacgacacga gcaccgcggt gtcgcggcgg       780
     ttgtgggccg acgcagccga cgaccagacc gaccgactcg ccgcgcacac ggtcgtcctg       840
     gccagcggcg ccaccttccc cgacgcgctg gccggaatac cgctggcttc gtacaagcag       900
     ggtccgttgc tgctgaccga accgcagcag ctgaccgaca ccacgcgtca ggagatccac       960
     cgtgtcctcc cgaagggcgg cactgtgtac gtgctcggcg gtcagaacgc agtctccccg      1020
     gacgtggcag cgacgctgtc cggcgacggg taccacgtga tccgctatgg cgggaagacg      1080
     cgctatgaga ccgcgctgat catcgccaag cagggcttgg acaaccccgc gcacgtcgtc      1140
     atcgccaccg gcaccgacta cccggacgcc ctggccgccg ggccggcagc caccgggcgg      1200
     ctgtcctcag gcggcaaacc ggccgcgatc ctgctgagcg acggcgccac tttcaacgac      1260
     gcggccaccg cggcgtacat ccgcagcaag ctggtgcgct accagaccgg catgccgaac      1320
     gtgacggcga tcggctggtc gtcgacgctg gccgggctgg cgatgatcgg cgtgccggac      1380
     tacatcatcg actcaacgat caagccgggc accccggcca agtccggcgg cgacagctgg      1440
     ggcacggaca tcgggaccct ctacttcatc gccggagccg accgctatac gaccgccgag      1500
     ggcgtcgcca tcgaggacac cggcccggac tgctgtgctc cggacgaccc gttcgtcggc      1560
     tacgcgtcgg gcaacggctt cgccgacgcg ttgaccggag gagcggcatt ggcgacactg      1620
     cacggtcggc tgttcctcac agctccgaac tatgtgccga ccgcgacgac cgcgattttc      1680
     ccgggaccgc ccgaccaggt gaagggcacc acctacaccg ggaccgtctt cggcggcact      1740
     caggccgttt cgcaaggagt cgaggatcgg ctggctcagg tgctggaggc caaggagcag      1800
     tga                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page