(data stored in ACNUC7421 zone)

EMBL: CP001700.PE5

CP001700.PE5         Location/Qualifiers
FT   CDS_pept        6140..6658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   sgr:SGR_3704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68960"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM1"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACU68960.1"
FT                   /translation="MNPQPVDNGSGAEGGDPQDSGVDLARAALAAARARGKDNGAGWSG
FT                   NRRRNSNSGQRSGSGPDERDPQLLSSAIPRMIEARGWSVPAAVGGVMGRWGEIVGSHIS
FT                   AHCTPVEFHDGVLMVRTDSAAWATELRMLAPQLLAKLNAELGTSRAAHGGRDAAGAIAT
FT                   LKVVGPGGR"
     gtgaatccac agcctgtgga caacggttcc ggcgccgagg gcggtgaccc tcaagactct        60
     ggcgtcgacc tggcccgcgc cgctttagcc gccgcacgcg cccgcggcaa ggacaacggc       120
     gccgggtgga gcggcaaccg ccggcgtaac agcaactccg gccagcgctc gggatccggt       180
     cccgacgaac gcgatccgca gctgctgtcc tcggcgatcc ccaggatgat cgaggccagg       240
     ggctggagtg tgccggcggc ggtcggcggc gtgatgggcc gctggggcga gatcgtgggc       300
     agccacatct cggcgcactg caccccggtg gagttccacg acggcgtcct catggtccgc       360
     accgattccg cggcctgggc caccgagctg cgcatgctgg cgccgcagct gctcgcgaag       420
     ctcaacgccg agctggggac gtcccgcgcg gcccacggcg gccgggacgc cgccggcgcc       480
     atcgcgaccc tgaaagtggt cggacccggc ggtcgctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page