(data stored in ACNUC7421 zone)

EMBL: CP001700.PE50

CP001700.PE50        Location/Qualifiers
FT   CDS_pept        complement(49782..50486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0050"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sgr:SGR_3318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69005"
FT                   /db_xref="GOA:C7QFR6"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR6"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACU69005.1"
FT                   /translation="MSVLGVAFTGVVAGVSAGLSVLCWPPRQQGHPARRLAFLATRNTT
FT                   ADHTRSRPWSAFLKRLRNNPWSTARHQRQHSEATARISPVAADLLAACLASGADPLRAA
FT                   EVVAYCLRPPGRLGTLGERAAAEMADRFQEVAHLLRLGGNPITTWRVVAAEPGLRPVAE
FT                   AIGRAGLSGAPPVASIRACATDLRKERHAASTAAARRAGVRGVAPLAGCFLPAFVLIGV
FT                   TPIVLGLAHHLL"
     atgagcgtcc tcggtgtcgc gttcaccgga gtcgtggctg gagtgtccgc gggcttgtcg        60
     gtgctgtgct ggccgccccg gcagcaggga caccccgcac gccgattggc ttttctggca       120
     acgcgaaaca cgactgcaga ccacacacgc tcgcgaccgt ggtcggcgtt tctcaaacgt       180
     ttgagaaaca atccctggag cacggcccgc caccagaggc agcacagcga ggcgacggcg       240
     cgcatatccc ccgtcgccgc ggatctgctc gccgcgtgtc tggcttccgg cgccgatcca       300
     ctgcgcgccg ccgaagtggt ggcgtactgc ctgcgaccgc cggggcggct gggcacgctc       360
     ggcgaacggg ccgcagccga gatggcagac cgcttccagg aggtcgcgca cctgctgcga       420
     cttggcggca acccgatcac cacctggcgc gtggtcgccg ccgaacccgg cctgcgcccg       480
     gtcgccgaag ccatcggccg cgccggactg tccggtgccc cgccggtcgc ctcgatccgt       540
     gcctgcgcaa cggatctgcg caaggagcgg catgccgcga gcaccgccgc cgcgcgccgt       600
     gccggggtcc gcggcgtggc accgctggcc ggctgcttcc tgcccgcctt cgtgctgatc       660
     ggggtcacgc cgatcgtcct gggcctggcc caccacctgc tctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page