(data stored in ACNUC7421 zone)

EMBL: CP001700.PE500

CP001700.PE500       Location/Qualifiers
FT   CDS_pept        591312..593135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0509"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: fal:FRAAL6687
FT                   putative potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69455"
FT                   /db_xref="GOA:C7PXA4"
FT                   /db_xref="InterPro:IPR003032"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA4"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACU69455.1"
FT                   /translation="MADRLRYQLPARPTTTLRWVFFVLAVVSLVFGYVGLHAYILQQKP
FT                   HPQYSHAPGDLIYFDIELFLVQSTPIAAGGPYPFLLAVARFSAPLVSAYTIVEIALGLS
FT                   AHRIHGVRMRRYRGHAVVCGSSRTATVLAERLRRDRRRVVTIEPGTDDRRRADVVIGDP
FT                   ALPARLREAGVERAAVVYSCLDDSHRNVEVAGTIERIRAHTDRPGRADRPGHVGRPGRR
FT                   GPVRVHAMVKDLDLCLALKARHWSTAGGDGPYVDFYNPDELAAQDVVRSDDRLFTHDPP
FT                   RVAIAGTGAFGRAVLVELGRQWLVRRKQSSASLQVKVIGEQALKEVAAVAARYSFLDEV
FT                   CMVQTRTGTPAEFLTELTRLDTPRLHRLYLCQEDEGQALGTALAAVAHLSSALEVIVVR
FT                   LDRMSGMARAFDHGTGAGALFDGLDGRLRIVDVAQVGGDPAVIGFDLAEALARTSHQRY
FT                   LLERLASGKPLGSAPAMTPWETLDEDLRAASRALAGDVGRKAAALGGLLVPRSASGQDF
FT                   AFQPGEIEALARREHDRWQAERTGRGWRYGPRRDPVAKRHPDLNSWAQLPESERERDRE
FT                   VVRAMPSVLAEVGLAIVRVGPSEFTAEELAA"
     atggcagacc ggctccgcta tcagctgccg gcccggccca ccaccacgct ccgctgggtt        60
     ttcttcgtac tcgcggtcgt cagcctggtg ttcggctacg tcggcctgca tgcctacatc       120
     ctgcagcaga aaccccatcc gcagtacagc catgcgccag gcgacctcat ctacttcgac       180
     atcgagctct tccttgtgca gtccacgccg atcgcggccg gcggtccgta cccgttcctg       240
     ctggcggtgg cccgtttctc ggcgccactg gtgagcgctt acacgatcgt ggagatcgcg       300
     cttgggctgt cggcgcatcg gatccacggg gtccggatgc ggcggtatcg cggacacgcc       360
     gtggtctgtg gctcgtcgcg gacggcgacc gtgctcgccg agcggcttcg gcgggaccgc       420
     cgccgggtgg tgaccatcga gcctggcacc gacgatcgac ggcgcgccga cgtggtcatc       480
     ggcgacccgg cgctgccagc ccggctgcgc gaggcgggtg tcgagcgcgc ggcagtggtc       540
     tacagctgcc tggacgacag ccaccgcaac gtcgaggtgg ctgggacgat cgagcggatc       600
     cgggcccaca cggaccgccc gggacgtgca gaccgacccg gacacgtggg acgtccggga       660
     cgacgcggcc cggtgcgagt gcacgcgatg gtgaaggacc tcgacctgtg tctggccctg       720
     aaagcgcgcc actggagcac cgccggcggc gacggtccgt acgtcgattt ctacaacccc       780
     gacgagttgg ccgcgcagga cgtcgtccgc tctgacgacc ggctgttcac ccacgatcca       840
     ccccgcgtgg ccatcgccgg caccggagcc ttcggccggg cggtactggt ggaactgggc       900
     aggcagtggc tggtccgccg caagcagtcg tcggcatcac tgcaggtgaa ggtgatcggg       960
     gagcaggcac tcaaggaggt cgccgccgtc gcggcccgct actcgttcct cgacgaggtc      1020
     tgcatggtgc agacccgcac ggggactccg gcggagttcc tgaccgagct cacccgcctc      1080
     gacacgcccc gcctgcaccg cctctacctc tgccaggagg acgaaggcca ggccctcggc      1140
     accgcgctcg ccgccgtcgc gcacctgtcg tccgcattgg aggtgatcgt ggtgcggctg      1200
     gaccggatgt ccggcatggc ccgcgccttc gaccacggca ccggggccgg agctctgttc      1260
     gacggcctgg acggccggct ccgcatcgtc gacgtcgccc aggtcggcgg cgacccggcc      1320
     gtcatcggct tcgacttggc cgaggccttg gcgaggacca gccaccagcg ctacttgctg      1380
     gaacggctgg ccagcggcaa gccgctgggc agcgcgccgg ccatgacccc gtgggagacc      1440
     ctggacgagg acctgcgggc ggcatcccgg gcgctggccg gcgacgtcgg ccgcaaggcg      1500
     gccgccctgg gcggcctgct ggtcccccgg agcgcctccg gccaggactt cgccttccaa      1560
     cccggcgaga tcgaggcact ggcccgccgc gagcacgacc gctggcaggc cgagcggacc      1620
     ggccgcggct ggcgctacgg accgcgccgg gaccccgtcg cgaaaaggca tccggacctg      1680
     aactcttggg cgcagctgcc ggagtcggag cgggagcgcg accgggaggt ggttcgggcc      1740
     atgccctcgg tgctggccga ggtcgggctg gcgatcgtgc gggtcgggcc atcggagttc      1800
     acggccgagg aactcgcggc gtga                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page