(data stored in ACNUC7421 zone)

EMBL: CP001700.PE501

CP001700.PE501       Location/Qualifiers
FT   CDS_pept        complement(593159..593641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa54480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69456"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA5"
FT                   /inference="similar to AA sequence:KEGG:nfa54480"
FT                   /protein_id="ACU69456.1"
FT                   /translation="MRLGITGHLDLTVSTERAVVAALRRHLLACGVPGELIGVSCMARG
FT                   ADSLFAQALIELGGRLEVIIPSVDYRQSQVTPDHEPVFSAMLDRAAAVHQMPAARAAAE
FT                   AYAEANRLLLASIDELVAVWDGGLDGPVGGTMDVVLTALACGIPVTVIWPEGAERG"
     gtgcgacttg ggatcactgg acacttggat ttaaccgtct cgaccgagcg cgcggtcgtg        60
     gccgcgttac gacggcacct gcttgcctgc ggggttccag gcgaactgat cggcgtcagt       120
     tgcatggcgc gcggggcgga cagcctcttt gcccaagcgc tgattgagct aggggggcgc       180
     ctggaggtca tcattccctc ggtggactat cggcaatcac aggtcactcc ggaccacgag       240
     ccggttttct ccgcgatgct ggaccgcgcg gccgccgtac atcagatgcc cgccgcccgc       300
     gccgccgccg aagcctacgc ggaggccaac cggctactgc tggcatccat cgacgaactg       360
     gtggcggtct gggacggcgg gctcgacggg ccggtgggcg ggacgatgga tgtcgtgctg       420
     accgccctgg cgtgcggcat cccggtgacg gtgatctggc cggagggagc cgagcgcggg       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page