(data stored in ACNUC7421 zone)

EMBL: CP001700.PE502

CP001700.PE502       Location/Qualifiers
FT   CDS_pept        593867..594040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69457"
FT                   /db_xref="InterPro:IPR026334"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69457.1"
FT                   /translation="MLHPKNDAKPGQATAVTDSRDTPLGRVSESAASTLFRIVRACDEP
FT                   LTPPVAAFDASL"
     atgttgcacc ctaagaacga tgccaagccc ggccaagcaa cagccgtgac cgatagccgc        60
     gacacgcccc tgggccgagt ctccgagagc gcagcgagta ccttgttccg aattgtgcgg       120
     gcctgtgacg agccgctgac gccgcccgtg gccgcgttcg acgcctcgct gtag             174
//

If you have problems or comments...

PBIL Back to PBIL home page