(data stored in ACNUC7421 zone)

EMBL: CP001700.PE503

CP001700.PE503       Location/Qualifiers
FT   CDS_pept        594069..596516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0512"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   saq:Sare_2654 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69458"
FT                   /db_xref="GOA:C7PXA7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026335"
FT                   /db_xref="InterPro:IPR026337"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACU69458.1"
FT                   /translation="MSEQIVFPFRQFILKVHSRCDLACNHCYMYEGADQSWQARPKVMS
FT                   LETAERIGGRIADHARRHGVDSVRLILHGGEPLLAGTEQLEGIILRLRKVLDGITADIR
FT                   VHTNAVRLDARFLDLFVKHDVRVGVSLDGDRLANDRHRLYSDGRTSHPQVRAALALLRR
FT                   PEYEHLYSGILCTVDIANDAIAVYEALLAEKPPRIGLLLPHATWDIPPPRPLDPGTGAP
FT                   SATAYADWLITIFDRWRADGRPMGIRIFDSVSSTLHGGPPLSEALGLAPSDLVVIETDG
FT                   EIEQLDSLKVAFDGAPKTGLTVADDDLDLALAHPGMRARQSGLAGLSEQCRSCEVVESC
FT                   GGGLFPHRYQSDSGFDNPSVYCEDLKKLILHIAQSDRRRADHGRDSVTRHRIADAQLAE
FT                   LASGFGDAAAVTALMDVQASIARGLLATVAEQLAMRESPARTAWNALIELDRAQPTALA
FT                   AVLAQPYFRTWAHRVLSAGVRDHDAHRLSALTLAVAVHAGSELELTLHAEQGAIHLPWL
FT                   GTLRVPGPSSYVRVATTAPNRLLIGTGPDRFAVTLDDETPAGLWEPIRTLHSEGFAILL
FT                   DDGDPERDCYGWPATSRLSAADHDRWQQSFDAAWRLILADHPGYAPGLAAGLSTVTPLR
FT                   PAPAGRAKSATARQAPGAVGAALPDAPELLALLLLHEFQHVKLGAVLDAYDLYDESDRR
FT                   RYYAPWRDDARPIEGLLQGTYAHLAVTDFWRVQRLRAVGEAAETAEVNFARWRLHTAEA
FT                   IEVLAASGSLTELGQQFTDSMRATVAPWLDEPVSSQAGQAARSSAERHLAAYLRRAGHA
FT                   SDV"
     gtgtccgagc agatcgtatt tcccttccgg cagttcatcc tgaaggtcca tagccgctgt        60
     gacctggcat gtaaccactg ttacatgtac gagggcgcag accagtcctg gcaggcgcgg       120
     cccaaggtga tgagcctgga gaccgcggag cggatcggcg gccggatcgc cgaccacgcc       180
     cggcgccacg gcgtggattc ggtccggctg atcctgcacg gcggagagcc cctgcttgcg       240
     ggcaccgagc agctcgaagg tattatcctc cgcctgcgta aagtgctgga cgggatcacc       300
     gcagatatcc gcgtccacac caatgccgtc cggctggacg cgagattcct tgatcttttc       360
     gtcaagcatg acgtgcgggt aggtgtttcc cttgatggcg accggcttgc gaatgatcgc       420
     caccgcctct actccgacgg ccgcaccagc catccgcaag tacgcgcagc cttggcgctt       480
     ttacgccgcc ccgagtatga gcacctctat tcagggatct tgtgcaccgt ggacatcgcc       540
     aatgatgcca tcgcggtgta tgaggcattg ctggccgaga agccgccgcg catcggattg       600
     ctcctgccgc acgccacctg ggatattccg ccgccgcggc cgctggaccc gggtaccggc       660
     gccccgagcg ccaccgctta tgccgactgg ctgatcacga tcttcgaccg gtggcgggcc       720
     gacggacgcc cgatgggtat ccgcatcttc gactcggtgt cgtccacctt gcacggcgga       780
     ccgccgcttt ctgaagcctt ggggctggcg ccgagcgatc tcgtggtgat cgagaccgat       840
     ggcgagatcg agcagctgga ctccctcaaa gtcgccttcg acggcgcgcc gaaaaccggg       900
     ctcaccgttg ccgacgacga tctcgacctg gcgctggccc accctggaat gcgggcacgg       960
     cagtccggac tggccgggct ctccgagcag tgccggtcct gcgaagtggt cgagagttgc      1020
     ggtggcgggc tgttcccaca ccggtaccag agcgattcag gcttcgacaa tccttcggtc      1080
     tactgcgagg atctcaagaa gctgatcctg cacatcgcgc agagcgaccg tcgccgcgcc      1140
     gaccacggcc gcgactcggt gacccggcac cgcatcgccg acgcccaact ggccgagctg      1200
     gcctcgggct tcggcgacgc ggccgccgtt accgcgctga tggacgtcca ggccagcatc      1260
     gcccgtggtc tgctggcgac ggtcgccgag cagctggcga tgcgtgaatc gccggcccgc      1320
     acggcgtgga acgctctgat cgagctcgac cgtgcacagc cgacggcgct ggccgcggtg      1380
     ctcgcccagc cctacttccg gacctgggcg caccgcgtcc tgagcgcggg agtccgggat      1440
     cacgacgccc accgcttgag cgcgctcacc ctggcggtgg cggtccacgc cggtagtgag      1500
     ctggagctca cgctgcatgc cgagcagggg gcgatccacc tgccctggct gggcacgctc      1560
     cgcgtccccg gcccgagttc ctacgtccgg gtggcgacca cggcaccgaa ccgtctgctg      1620
     atcggtaccg gaccggaccg gttcgccgtc acgctcgacg acgaaactcc tgcaggtttg      1680
     tgggagccca tcagaaccct gcactccgaa ggcttcgcga tcctgctgga cgacggcgac      1740
     cccgaacgtg actgctatgg ctggccggcg acgtcccggc tgtccgccgc cgatcacgac      1800
     cgctggcagc agtcgttcga cgcggcctgg cggttgatcc tcgccgatca ccccggctac      1860
     gctcccggcc tagctgccgg gctgtccacc gtcacgccct tgaggccggc gcctgccggc      1920
     cgggcgaaaa gcgccaccgc acgacaagcg cccggcgcag tgggcgccgc gctcccggac      1980
     gcgcccgaac tgctcgcgct cttgctgctg cacgagttcc agcatgtcaa actcggcgcg      2040
     gtgctcgacg cctacgacct ctacgacgag tccgaccgcc ggaggtacta tgcgccgtgg      2100
     cgggacgacg cgcgtcccat cgagggactg ttgcagggga catacgcgca cctcgccgtc      2160
     accgacttct ggcgcgtcca acggctgcgc gctgtcggcg aagcggccga gacggcggaa      2220
     gtgaacttcg ccaggtggcg gctgcacacc gccgaggcga tcgaagtcct ggccgcatcg      2280
     ggctcgctca ccgagctcgg ccagcagttt accgacagca tgcgggcgac cgtcgctcca      2340
     tggctggacg agccggtcag ctcgcaggca gggcaggcgg cccgcagctc cgccgaacgg      2400
     caccttgcgg cctatctccg ccgtgccggc cacgcttctg atgtctga                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page