(data stored in ACNUC7421 zone)

EMBL: CP001700.PE504

CP001700.PE504       Location/Qualifiers
FT   CDS_pept        596509..597360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0513"
FT                   /product="Aminoglycoside N(3')-acetyltransferase"
FT                   /EC_number="2.3.1.81"
FT                   /note="PFAM: aminoglycoside 3-N-acetyltransferase; KEGG:
FT                   saq:Sare_2653 aminoglycoside N(3')- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69459"
FT                   /db_xref="GOA:C7PXA8"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA8"
FT                   /inference="protein motif:PRIAM:2.3.1.81"
FT                   /protein_id="ACU69459.1"
FT                   /translation="MSDSLEATHHAPIVRSRQQPCSRQQLAEDLVRLGLQSGTDALINS
FT                   SLRAIGPVDGGAATVLAALRAVLGPRATVVVPSQTPANSATSSAHREAVAGMTAVEIAG
FT                   YRERFPPFDPARTPSAGMGAFAEHVRLQPGACRSGHPTSSFAALGPAAERITALHPLHS
FT                   HLGPESPLGALAESGAQVLLLGVGFAKCTAFHLAEYRVRPETRTYSSKLADLSRPGGGG
FT                   RWIEYRAIRLDASDFDRLGADLAASRSWVRNGTVGAAPSACFPLASAVRFAEQWLSEHR
FT                   PG"
     atgtctgatt ccctggaagc cacgcatcac gcgccgatcg tgcgatcccg acagcagccg        60
     tgttcccggc agcagctcgc cgaggacctc gtccgcctcg gactccagag cggcacggac       120
     gcccttatca actcctcgct gcgggcgatc ggcccggtgg acggcggagc ggccacggtc       180
     ctcgcggcct tacgcgcggt gctcggcccc cgggcgaccg tcgtcgtacc ctcgcagacg       240
     cccgccaact ccgccacgtc cagcgcgcac cgcgaggcgg tggccggcat gacggcggtg       300
     gagatcgccg ggtaccggga acgctttccc cccttcgacc cggcccgcac cccgtcagcg       360
     ggcatggggg cgttcgccga acacgtccgg cttcagcccg gagcgtgccg cagcggccat       420
     ccgacgagtt cgttcgccgc gctcggcccg gccgccgagc gcatcacggc cctgcatccg       480
     ctgcacagcc acctcgggcc cgagtcgccg ctgggagcgc tggccgaatc cggggctcag       540
     gtgctgttgc tgggcgtggg cttcgccaag tgcacggcgt tccacctggc agagtaccgc       600
     gtgcgccccg agacccggac gtactccagc aagctggccg acctcagccg gcccggaggc       660
     ggcggccgct ggatcgagta ccgggcgatc cggctcgacg cttccgactt cgaccggctc       720
     ggcgctgacc tggccgcctc ccggtcctgg gtacgcaacg gcacggtcgg cgcggcgccc       780
     tcggcgtgct tccccctggc ctcagcggtt cggttcgcgg aacagtggct ttcggagcac       840
     cgacccggct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page