(data stored in ACNUC7421 zone)

EMBL: CP001700.PE505

CP001700.PE505       Location/Qualifiers
FT   CDS_pept        597481..598845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69460"
FT                   /db_xref="InterPro:IPR026367"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXA9"
FT                   /inference="similar to AA sequence:KEGG:SGR_5767"
FT                   /protein_id="ACU69460.1"
FT                   /translation="MSPSGPGEAESPRYSEYGSCFFLSYAHTPRVFDDGPDLNYWVRQF
FT                   FRDLCNELVSCDPTTWHRPTGPPGFMDDAIPEGALWRRVLARELATCRVFVPLYHRSYF
FT                   SSVNCGKEWAVFRARQMAQLAQTGVPNEAILPVVWKPPRSEDLPEFASALQMSRLSVSD
FT                   AYFERGLYELIRLDRDREYTNVVLRFAEWLDETARTCAPPLGPLADYELVRPLFPTDDS
FT                   GKGADRRFRITVAAPDEKSAPPGRSRDYYGPQPEDWRPYYPDSTVPLARRAEDVARGLG
FT                   YTPVVSALTRHSPEMRPRPRNPAAGAGAIPDAPGVLLVDPWIAHTPDSGSVAEVDRCHK
FT                   DWIRVLVPWSGTDRQTAEQAATLRSLLEGVMPWSMEEWHRTASAATRELASVADFGHAM
FT                   PDVMERAWRRYLRAVRPAGSGGREFPSRPRLRDGPDADADADGDAGASTDDGTED"
     atgagcccgt cgggccccgg ggaagcggaa tcgccgcggt actccgaata cggctcctgc        60
     ttcttcctga gctacgcgca caccccgcgc gtcttcgacg acggccccga cctcaactac       120
     tgggtccgcc agttcttccg cgacctgtgc aacgagctcg tgagctgcga tccgaccacc       180
     tggcatcggc cgaccgggcc gccgggcttc atggacgacg ccatccccga gggcgccctg       240
     tggcgccggg tcctggcccg ggaactcgcc acctgccgcg tgttcgtgcc cttgtaccat       300
     cgctcctact tctccagcgt caactgtggc aaggaatggg cggtcttccg cgcccggcag       360
     atggcgcaat tggcccagac cggcgtgccg aacgaggcga tcctgccggt ggtctggaag       420
     ccgccgcgat cggaggatct gccggagttc gcctcggcgc tgcagatgtc ccggctgagc       480
     gtcagcgacg cctacttcga gcgcggtctg tacgagctga tccggctgga ccgcgaccgt       540
     gagtacacca acgtcgtact gcggttcgcc gagtggctgg acgagacggc ccgcacctgc       600
     gcaccgccgc tcggcccgct ggccgactac gagctggtcc ggccgttgtt cccgaccgac       660
     gacagcggga agggcgccga ccgccggttc cggatcaccg tcgccgcccc cgatgagaag       720
     agcgcgcccc cgggccgcag ccgtgactac tacgggccgc agcccgagga ctggcgcccg       780
     tattaccccg actccaccgt gccgttggcc cggcgggccg aggacgtggc ccgcggcctg       840
     ggctacaccc cggtcgtcag tgccctgacc cgccactccc cggagatgcg gccgcgtccg       900
     agaaacccgg cggcgggcgc gggagccatc ccggacgcgc caggtgtgct gctcgtagac       960
     ccgtggatcg cgcacacccc ggactccggc agcgtcgccg aggtcgaccg gtgccacaag      1020
     gactggatcc gggtgctggt gccatggagc ggaaccgacc ggcagactgc cgagcaggcc      1080
     gccacattgc ggtcgctcct ggagggtgtg atgccgtgga gcatggagga gtggcaccgt      1140
     acggcctcgg ccgccacccg cgagctggcg agcgtcgcgg acttcggcca cgcgatgccc      1200
     gatgtgatgg agcgcgcctg gcggcgctat ctgcgggcgg tccggccggc cgggtccggc      1260
     gggcgcgagt tcccgtcgcg gccacgcctg cgggacggtc ctgacgctga cgctgacgct      1320
     gacggggacg cgggagcgag cacagacgac ggtaccgagg actga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page