(data stored in ACNUC7421 zone)

EMBL: CP001700.PE506

CP001700.PE506       Location/Qualifiers
FT   CDS_pept        598868..602812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0515"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="KEGG: sgr:SGR_5768 putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69461"
FT                   /db_xref="GOA:C7PXB0"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB0"
FT                   /inference="similar to AA sequence:KEGG:SGR_5768"
FT                   /protein_id="ACU69461.1"
FT                   /translation="MPEREGRVLTFYSYKGGCGRTMALANTAWILAANGRRVAVIDWDL
FT                   ESPGLHRYFPAPVLDPTALNGNLGVIDMVRDFEWAASRDEVPDPAQWYMDNARIRDLAI
FT                   SLRWPFPGGGCIHFVSAGLQNRAYSAAVGSLDWDRFYADLGGGRLFDAMRRDMIENYDY
FT                   TLIDSRTGFSDVADICTIHLPDVLVDCFTLNNQSIEGAAKVARSVHEHNRRRAIRILPV
FT                   PMRVDDGEKEKADAGRAAARARFEGFPQVDDPADAVRYWGAVEIPYRPFYAYEETLAVF
FT                   GDSPGLTTSLLAAYERLTGELTGGTVTSLPPIDDTRRISILDIVTRRRETVPEEVTVAY
FT                   IAEDRMWADWTAGVLRRSGVGASVRVLTPGIVTLPADGQRRRVLAIASTDFAGSGHALA
FT                   AARTLAGPEQLTAVLVSEPRADDRLGGLPSVDLHGLPEGPATARLLRALGKTDAEAVVS
FT                   GVTGEQTGGARFPAATPRVWSAPGRNATFTGRDAMLEKLRDGIVGSSSAVILPLALHGL
FT                   GGVGKTQLALEYAHRFKADYDLVWWIEAEQPDFIDTSLADLAIRLGLRGGDNVPEAAEA
FT                   AREALRRGTPYNRWLVVYDNALEPEVLTPYLPDLPGDGTGHILITSRIQSWSRVANSLE
FT                   VDVFTPEESVRHLTRAVPGLAQADAAAIAELVDNLPLAVESAASWLATTGTPVATYLES
FT                   LAEETTRVLSLGRPETYPVSLAVTWNLALQRLREREPAATRLLELAAFMNPDGIAMDLV
FT                   QSDEMVIALHPFNEFVTERMVIGNVVREIVVLSLIKVDPNTNALRMHRLVQEAVKATLD
FT                   DGSAQETIHEVHRILAGARPQFGDTDNPENWPRYQIIWPHLSPSRAIDCEEEPVRQLLI
FT                   DRVRFLWKTGDYAHALDFGRTLEKRWAERIEDYGSESTAGLALNRQFLNLRCQLATVLR
FT                   LRGEFRWAYDLDVEVLAEQQRVLPPRHPHTLLTAIGLAADLRGLGRFDDALEMDKATYA
FT                   DHKQAFWEDHPRALLSAHNLAVSYRLVGDFAQARAIDQDTLNRRKAVLGDRHPAALFSA
FT                   AHLARDLRETGHFEVSVELLRSTLADYRDVVGENAPETLRTAKSLAVSLRKADHLEEAL
FT                   ALSRDTYEHYLADYAPHNPDVLACAVNLAADFAATGDARSAVKIMDETLRAYRENLGRD
FT                   HPYTLVSLNNLGAFTRQAGIPDRARRHIKAAHGGFDAWLGPEHPYTLAAAANLTNSMVD
FT                   AGELEEAETMELAAAGIFEATLGADHPDTLAVSANRVATLKAMAREAEANTLRAGVMAA
FT                   LERTLGAEHGITRALAEGRRLDFDLEPQPT"
     atgccggagc gcgaaggccg ggtgttgacc ttctactcgt acaagggcgg atgcggccgt        60
     acgatggcgc tggcgaatac tgcctggatc ctcgccgcga acggccggag agtcgcggtc       120
     atcgactggg acctggaatc tccgggactg caccgttact tcccggcccc ggtcctggac       180
     ccgaccgcgc tcaatgggaa cctcggcgtg atcgacatgg tccgcgactt cgagtgggcc       240
     gcgagccgcg acgaggtgcc ggacccggca cagtggtaca tggacaatgc ccggatccgg       300
     gatctggcca tcagtctgcg ctggccgttc ccgggcggcg gttgcatcca cttcgtgtcc       360
     gccggcttgc agaaccgggc gtactcggcc gcggtgggga gtctggactg ggacaggttc       420
     tacgccgacc tcggcggcgg ccggctgttc gacgcgatgc gccgcgacat gatcgagaac       480
     tacgactaca cgctcatcga cagccgcacc ggcttcagcg acgtggccga catctgcact       540
     atccacctgc cggacgtgct cgtcgactgc ttcaccctca acaaccagag tatcgaaggc       600
     gccgccaagg tagcgcgctc ggtccacgag cacaatcggc ggcgggccat caggatcctg       660
     ccggtaccga tgcgcgtgga cgacggcgag aaggagaagg ccgacgccgg gcgcgccgcg       720
     gcccgggccc gcttcgaagg cttcccgcag gtcgacgacc cggccgacgc ggtccgctat       780
     tggggcgccg tcgaaatccc ctatcggccg ttctacgctt atgaggagac tctcgccgtc       840
     ttcggcgact ccccgggcct gaccacctcg ctgttggccg cctacgagcg gcttaccggc       900
     gagctcaccg gcggcaccgt cacctcgctc ccgccgatcg acgacacgcg gcggatcagc       960
     atcctcgaca tcgtgacccg ccggcgcgag acggtgccgg aggaggtcac cgtcgcctac      1020
     atcgccgagg accggatgtg ggccgactgg accgccgggg ttctgcggcg ctccggggtc      1080
     ggtgcctcgg tgcgggtcct gacgcccggc atcgtcactc tgccggccga cggccagcgc      1140
     cgccgggtgc tcgcgatcgc ctcgacggac ttcgccggct ccgggcacgc cctggcggca      1200
     gcccgcaccc tggcaggccc cgagcagctg acggcggtcc tggtgtcgga gccgcgggcc      1260
     gacgaccggt tgggcgggct gccgtcggtg gacctgcacg gcctgcccga gggtccggcc      1320
     accgcccggc tgctgcgcgc gctcggcaag accgatgccg aggccgtcgt aagcggcgtc      1380
     acgggggaac agaccggcgg cgcccgtttc ccggccgcca ccccgcgggt gtggagcgca      1440
     cccggccgca acgccacgtt caccggccgc gacgcgatgc tggagaagct gcgcgacggg      1500
     atcgtcggca gctcctcggc ggtgatcctg ccgctggcac tgcacgggct cggtggtgtc      1560
     ggcaagaccc agctggccct ggagtacgct caccgcttca aggccgacta cgacctggtc      1620
     tggtggatcg aggccgagca gccggacttc atcgacacct cgctggccga cctcgcgatc      1680
     cggctgggcc tgcgcggcgg cgacaacgtc ccggaggccg ccgaggcggc gcgcgaggcg      1740
     ctgcgccgcg gcacgccgta caaccgctgg ctcgtcgtgt acgacaacgc gttggagccg      1800
     gaggtgctga cgccgtatct gccggacttg cccggcgacg ggaccggcca catcctgatc      1860
     acctcgcgca tccagtcctg gtcgcgggtg gccaactcgc tcgaggtgga cgtcttcacg      1920
     ccggaagaga gcgtcagaca cctgacgcgc gccgtgccgg gcctggcgca ggccgacgcc      1980
     gcggccatcg ccgaactcgt cgacaacctg cccctggccg tcgagagcgc ggcgtcctgg      2040
     ctggcgacga ccggcacgcc ggtggcgacg tacctggagt cgctggccga ggagacgacg      2100
     cgggtgctgt cgctcggccg ccccgagacg tatccggtgt cgctggccgt gacctggaac      2160
     ctggctctgc aacgcctgcg cgagcgggag ccggcggcga cccgcctgct ggagctggcg      2220
     gcgttcatga accccgacgg catcgccatg gacttggtgc agtccgacga gatggtcatc      2280
     gccctgcacc cgttcaacga gttcgtgacc gagcgcatgg tgatcgggaa cgtggtgcgc      2340
     gagatcgtcg tgctgtccct gatcaaggtg gacccgaaca ccaacgcgct gcgtatgcac      2400
     cgcctggtgc aggaggccgt taaggcgacg ctggatgacg ggagcgccca agagaccatc      2460
     cacgaggtgc accgcatcct ggccggcgcc cggccgcagt tcggcgacac cgacaacccg      2520
     gagaactggc cgcgctacca gatcatctgg ccgcacctgt cgccgtcacg cgccatcgac      2580
     tgcgaggagg agccggtgcg ccagctcctc atcgaccgcg tgcgcttcct gtggaagacc      2640
     ggcgactacg cacacgctct ggatttcggc cgcaccctgg agaagcgctg ggccgagcgg      2700
     atcgaggact acggctcgga gagcacggcc gggctcgcgc tcaaccggca gttcctcaac      2760
     ctgcgttgcc agctggccac ggtgctgcgg ctgcgcggcg agttccggtg ggcctacgac      2820
     ctggacgtcg aggtgctggc cgagcagcag cgggtgctgc cgccgcgcca cccgcacacc      2880
     ctgctcaccg cgatcggcct ggccgcggac ctgcgcggcc tgggccggtt cgacgacgcg      2940
     ctggagatgg acaaggccac ctacgcggac cacaagcagg ccttctggga agatcatccg      3000
     cgagccctgc tgtcggccca caacctcgcg gtctcctacc gcctggtcgg cgacttcgcc      3060
     caggcccggg cgatcgatca ggacaccctg aaccgccgca aggcggtgct cggcgaccgg      3120
     cacccggcgg cgctgttctc ggccgcgcac ctggcgcgcg acctgcgcga gaccgggcac      3180
     ttcgaggtct cggtcgaact gctgcgctcg accctggccg actaccgcga cgtggtcggc      3240
     gagaacgccc cggaaaccct gcgcaccgcc aagagcctcg ccgtctcgct gcgtaaggcc      3300
     gaccacctgg aggaggcgct ggccctgagc cgcgacacgt acgagcacta tctcgccgac      3360
     tacgcgcccc acaacccgga tgtgctggcc tgcgcggtaa acctggccgc cgacttcgcg      3420
     gccaccggcg atgcccggtc cgcagtcaag atcatggacg agacgctgcg ggcctaccgc      3480
     gagaacctgg gacgggacca cccctacacc ctggtctcgc tgaacaacct cggcgccttc      3540
     acccgccagg ccgggatacc cgaccgggcc cgtaggcaca tcaaggcggc gcacggcggt      3600
     ttcgacgcct ggctcgggcc ggagcacccc tacactctgg ccgccgccgc gaacctgacg      3660
     aacagtatgg tcgacgccgg cgaactcgag gaggccgaga ccatggagct cgcggcggcc      3720
     gggatcttcg aagcgacgct gggggcggac caccctgaca cgctcgctgt ctcggccaac      3780
     cgagtggcga cgctgaaggc gatggcgcgc gaggccgaag ccaacacgct gcgggccggg      3840
     gtcatggccg ccctggaacg caccctcggt gcggagcacg gcatcacgcg ggccttggcc      3900
     gaggggcggc ggctggactt cgatctggaa ccgcagccga cctga                      3945
//

If you have problems or comments...

PBIL Back to PBIL home page