(data stored in ACNUC7421 zone)

EMBL: CP001700.PE507

CP001700.PE507       Location/Qualifiers
FT   CDS_pept        complement(602879..603754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0516"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sgr:SGR_5769 putative alpha/beta hydrolase fold protein
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69462"
FT                   /db_xref="GOA:C7PXB1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69462.1"
FT                   /translation="MTRIVQAQDGRKLAVEEWGAPDGAAVFLMHGTPGSRFGPRPRESV
FT                   LYRLGVRLIAYDRPGYGESDRLGARAVAHAAGDVAAIADALGLDRFAVLGRSGGGPHAL
FT                   ACACLLGDRVRCAAVLVGLAPRDAGGLDWYAGMTASNVAAYQTAESGARAIAARFEAQA
FT                   ALIRRDPAAHLPYRDRELSRSDQEVMADIGIRTMMLSNFAEAVKRSGVGWIDDALSFVA
FT                   AWGFDPARINVPVLLWHGARDVHAPVRHTIWLAERITDSHPVIVDDAAHFGALSAMPRV
FT                   LSWLVDGKRP"
     gtgacgagga tcgtgcaggc tcaggacggc cggaaactgg ccgtggagga gtggggcgca        60
     ccggacggtg ccgccgtctt cctgatgcat ggaacgcccg gcagccggtt cgggccgcgt       120
     ccccgcgagt cggtgctgta ccggctgggg gtacggctca tcgcatacga ccggcccggg       180
     tacggggagt ccgaccggct gggcgcccgg gctgtggcgc acgcggccgg ggacgtggct       240
     gccatcgccg acgcgctcgg gctggaccgc ttcgcggtgc tcgggcggtc cggcggcgga       300
     ccgcacgccc tggcctgcgc ctgtctgctc ggcgaccgcg tgcggtgcgc ggcggtgctg       360
     gtcgggctgg cgccccggga cgccggcggg ctggactggt acgccgggat gaccgcctcg       420
     aacgtagccg cgtaccagac cgccgagtcc ggggcgcggg ccatcgcggc gcggttcgag       480
     gcgcaggcag cgttgatccg gcgagatccg gccgcgcatc tgccttatcg ggaccgggag       540
     ctgtcgcggt ccgaccagga ggtgatggcc gacatcggaa tcagaaccat gatgttgtcc       600
     aacttcgccg aggctgtgaa gcggtccggg gtggggtgga tcgacgacgc gctgtcgttc       660
     gtcgccgcgt ggggcttcga tccggccaga atcaacgtgc cggtactgtt gtggcacggc       720
     gcgcgcgacg tgcacgcccc ggtgcggcac acgatatggc tcgccgagcg catcaccgat       780
     agccatccgg tgatcgtcga cgacgcggcg cacttcggtg ccctgtctgc gatgccccgg       840
     gtgctgtcgt ggctggtcga cggcaagcgg ccgtga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page