(data stored in ACNUC7421 zone)

EMBL: CP001700.PE509

CP001700.PE509       Location/Qualifiers
FT   CDS_pept        complement(604946..605989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0519"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fre:Franean1_3414 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69464"
FT                   /db_xref="GOA:C7PXB3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACU69464.1"
FT                   /translation="MVAALRLWRCRDDHKTIEILLLRHQLTILQRRLAAAGRRLRPDWA
FT                   DRAIIALLLGLVPKARRAGPCLFVTPDTILRWHRDLLRRRWAKKSRPKNDRRATHQNIK
FT                   TLIPRLARQNPAWGYRRIHGELAGLGIAIAASTVWEILKDAGVDPAPRRGSVTWASFLR
FT                   SQAEGIIAADFFTADLLDGTKVYVLTIIEHASRRIRVLGSTLHPTGQWTAQMARNLVMD
FT                   LDDAAATVKFLIRDRGTNFTEAFDTVLADAGIRTVLCNVQTPRMNAIMESWVGSVRRGL
FT                   LSRTLIWNHEHLRQILHHYELRHNTHRPHMSLSAAAPLKPLPPNITDLDALRVRRTRRA
FT                   GGVINEY"
     gtggtcgccg cccttcgatt atggcggtgc cgcgacgatc acaagaccat cgagatcctg        60
     ctgctccgcc accaactcac catcttgcag cgccgacttg ccgcggcagg aagacgtctg       120
     cgacctgact gggccgatcg cgcgattatc gcgctgctgc ttggtctggt gccgaaggcg       180
     cggcgggctg gaccgtgtct gttcgtcacc ccggatacga tcctgcgctg gcaccgcgac       240
     ctgctgcgcc gccgctgggc gaagaagtcc cgcccgaaga acgaccgtcg ggccacccac       300
     cagaacatca agaccctgat tccacgcctg gcccgacaga acccggcctg gggataccgt       360
     cgaatccatg gcgagttggc cggactcggc atcgccatag ccgcctccac cgtctgggag       420
     atcctcaagg acgccggcgt cgatccggct ccgcgacgcg gctcggtgac ttgggcgagt       480
     ttcctgcggt cccaggccga agggatcatc gctgctgact tctttaccgc cgacctcctg       540
     gacggcacga aagtctacgt tctgaccatc atcgagcacg cctcccgccg gatccgtgtc       600
     ctcggcagca cgcttcatcc gaccggccag tggaccgcgc agatggcacg caatctggtc       660
     atggacctcg acgacgccgc tgccacagta aagttcctga tccgcgaccg cggcaccaac       720
     ttcaccgaag ccttcgacac cgtcctggcc gatgcaggca tccgcaccgt gctgtgcaac       780
     gtgcagaccc cacgcatgaa cgcgatcatg gaaagttggg ttggctcggt ccgccgcgga       840
     ctcctgagcc gcaccctgat ctggaaccac gagcatctgc gccagatcct gcatcactac       900
     gaactgcgcc acaacactca ccggccgcac atgagcctgt ccgcagccgc accactcaag       960
     ccgctgccgc cgaacatcac cgacctcgac gccttgcgag tccgacgaac ccgccgcgcg      1020
     ggcggcgtca tcaacgagta ttga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page