(data stored in ACNUC7421 zone)

EMBL: CP001700.PE51

CP001700.PE51        Location/Qualifiers
FT   CDS_pept        complement(50483..51295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0051"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: sco:SCO3555 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69006"
FT                   /db_xref="GOA:C7QFR7"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR7"
FT                   /inference="similar to AA sequence:KEGG:SCO3555"
FT                   /protein_id="ACU69006.1"
FT                   /translation="MNSALAGLLAASAVLAFPGPGARRRLETAVLGAPRGPKWRLRMAG
FT                   AWPTVLSAIALGVLSALLARSMVLAFLVPFGAWRAYRAWTAHTARLAVERRQTEIIELC
FT                   VTICSELHAGREAREALRDAAVGACPDLAVHLVGPLGTGDDVVTVLRTAAGTPGREALA
FT                   ALAACWQVAEGGAGMTAAIGELSDGLRAERAQRRELDAELAGIRTSARLLAMLPVVGLI
FT                   IGSGMGLSPIPMLLHTGVGETCLVLGIAFVLGGVMWMDRIARSAEALS"
     atgaactccg cattggccgg gctgctggcc gcttcggcag tgctggcctt ccctggtccg        60
     ggcgcgcgcc gacgcctgga gaccgcggtg ctcggcgctc ctcgcggccc gaaatggcgg       120
     ctgcggatgg ctggcgcgtg gccgacggtg ttgtcggcga tcgcgttggg cgtgctgagt       180
     gctctgttgg cccggtcgat ggtgctggcc tttctggtgc cgttcggcgc gtggcgggcg       240
     tatcgggctt ggacggcgca taccgcgcga ttggctgtcg agcgcaggca gaccgagatc       300
     atcgagctct gcgtcaccat ctgttcggag ctgcatgccg gacgggaggc gcgcgaggct       360
     ttgcgcgacg ctgccgtcgg cgcgtgcccg gatctggcgg tgcacttggt cggaccgctc       420
     ggtaccgggg acgacgtggt gaccgtgctg cgtacggctg ccgggacgcc tggccgtgaa       480
     gcgctcgccg cgctggctgc gtgttggcag gtcgctgagg gcggcgcggg gatgaccgcg       540
     gcgatcgggg aactgtccga cggactgcgg gccgagcggg cccagcgccg ggagttggac       600
     gccgagctcg ccgggatccg tacctcggcg cggttgctgg cgatgctgcc ggtggtgggg       660
     ttgatcatcg gttccggcat gggactctcg ccgattccga tgctgctgca caccggcgtc       720
     ggcgagacat gtctggtgct gggaatcgcg ttcgtgctcg gcggcgtgat gtggatggat       780
     cggatcgcgc ggtcggcgga ggcgctgtca tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page