(data stored in ACNUC7421 zone)

EMBL: CP001700.PE510

CP001700.PE510       Location/Qualifiers
FT   CDS_pept        complement(607757..608035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69465"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69465.1"
FT                   /translation="MLQAVQSTADGMRVSTLLNSLFGWVPCPDDPWQQVIGIQHDLIKI
FT                   GHDRGPGAIDILVALTAVQHRLTVLHLDNDFAAIAKVRPDIQVQQLE"
     atgctccagg cagtgcagtc caccgccgac gggatgcggg tctccacgct gctgaacagc        60
     ctgttcggct gggtgccctg cccggacgac ccgtggcagc aggtcatcgg gatccagcac       120
     gatctcatca agatcggaca cgatcgcggt ccaggcgcta tcgatatcct ggtcgccctc       180
     accgccgtgc agcaccgcct gactgtgcta cacctggaca acgatttcgc ggcgatcgcc       240
     aaagtccggc cggacatcca ggtccagcag ctggaatag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page