(data stored in ACNUC7421 zone)

EMBL: CP001700.PE512

CP001700.PE512       Location/Qualifiers
FT   CDS_pept        610077..610766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69467"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69467.1"
FT                   /translation="MRDRDTLGRMFLPEFRYAHYVSKDVENGEAMKLRRSVAVLVAACG
FT                   FSLASIAGAAAQVATPSTTPVALSHVLRGEEQLSLQQLLDIASHKVRGTYPNATLMLAD
FT                   GASPTGSTRNMDEVTDWRLIYNTNDAGSPVKSLELYATLEGEISHPVLRDQPWGGTVSI
FT                   PNQVGISPDLAYSILMDAGHNDPYQYVSLVKPLIANPHLQYHFSNIRGGCDGYAVNVDD
FT                   YAVNPIC"
     gtgcgcgacc gcgacacgct gggacggatg tttctaccag agttccgata tgcccactat        60
     gtctcgaaag acgtcgagaa cggagaggca atgaagctca ggagaagtgt cgcggtcctg       120
     gtcgccgcgt gtggattctc gctggcaagc atcgcggggg ccgcagctca ggtcgccacg       180
     ccgtcgacca cgcccgtcgc cctcagccac gtcctgcggg gcgaggagca gttgtcgttg       240
     cagcagctgc tcgacatcgc ctcccacaag gtccggggca cgtacccgaa cgcgacgctc       300
     atgctggccg acggcgcctc gccgaccggc agcacgcgga atatggacga ggtcaccgac       360
     tggcggctca tctacaacac caacgacgcc ggttccccgg tcaagtccct cgagctgtac       420
     gcgacgctcg agggcgagat cagccacccg gtgctgcgcg accagccgtg gggcggcacc       480
     gtgagcatcc cgaaccaggt cggcatctcc ccggacttgg cgtacagcat cctgatggac       540
     gccggccaca acgacccgta ccagtacgtc tcgctggtca agccgctcat cgccaacccg       600
     cacctgcagt accacttctc caacatccgg ggtggctgcg acgggtacgc ggtcaacgtc       660
     gacgactacg ccgtgaaccc tatctgttga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page