(data stored in ACNUC7421 zone)

EMBL: CP001700.PE513

CP001700.PE513       Location/Qualifiers
FT   CDS_pept        complement(611024..611197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC0254 Na+/H+-exchanging protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69468"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69468.1"
FT                   /translation="MTSQQTYALLFDIAVILAPAHALGGLARRFGQPAVIGEISLGIPL
FT                   GPTVVPAAVGRH"
     gtgaccagcc agcaaactta cgccctgctg ttcgacatcg ccgtgatcct cgcgccggcg        60
     cacgcgctgg gcggcctggc ccgcaggttc ggtcagccgg cggtcatcgg cgagatctcg       120
     ctcgggatac cgctcggccc gacggtcgtg ccggcggcgg taggccggca ctga             174
//

If you have problems or comments...

PBIL Back to PBIL home page