(data stored in ACNUC7421 zone)

EMBL: CP001700.PE514

CP001700.PE514       Location/Qualifiers
FT   CDS_pept        complement(611375..612217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0526"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold protein; KEGG:
FT                   sen:SACE_3708 abhydrolase, alpha/beta hydrolase fold
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69469"
FT                   /db_xref="GOA:C7PXB8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU69469.1"
FT                   /translation="MASGIRHVVVDADGVDIPVTLRGNGPLVLLLPGATGLQTGYAVLI
FT                   KLLSADHTVAVYDRRGHGRSKEKEPSTAPLSIEQHAMDAAVLIDALGEGPVHAVGSSAG
FT                   AVIGLDLLARYPDRVRSLIAHEPSLLPLIDDGPRWRTWYDDLVAIDREVGTRHAFDYFF
FT                   AHLASNGRGEQAPVAIPSSQLPEWSLYFQRELTEIVSYEPDLEQVALDRDAFVPVLGAD
FT                   SRERWHGRVVLELAARVGVPAVEVAGGHLAPVYEPAAFHRLIQDNVTLHEKLRASQLS"
     atggcatcgg gaatcaggca tgtggtcgtc gacgcggacg gcgtcgacat ccccgtgact        60
     ctgcgtggaa acggcccgct cgtcctgctg ctccccggcg cgaccggtct gcagacggga       120
     tatgcggtac tgataaagct gctgtccgcg gaccacaccg tcgcggtcta cgaccggcgc       180
     ggtcacggcc gcagcaagga gaaggaaccg agcaccgcac cgctgtccat cgagcagcac       240
     gcgatggacg ccgcggtcct catcgacgcc ctgggcgagg ggcccgtgca cgccgtcggc       300
     agcagcgcgg gtgcggtcat cggcctggac ctgctggccc gctacccgga ccgggtgcgc       360
     tccctgatag cgcacgaacc ctcgctgctc ccgctcatcg acgacggccc gcgctggcgc       420
     acctggtacg acgacctcgt ggcgatcgac cgggaggtcg ggacccgcca tgccttcgac       480
     tacttcttcg cccacctcgc gtcgaacggc cgcggcgagc aggccccggt ggcgatcccc       540
     agctcgcagc tgccggagtg gagcctctac ttccaacgcg agctgaccga gatcgtctcc       600
     tacgaaccag acctggagca ggtggccctg gaccgggacg cgttcgtccc ggtgctcggc       660
     gcggacagcc gcgagcgctg gcacggccgg gtcgtcctgg aactcgccgc gcgcgtggga       720
     gtccccgcgg tcgaggtcgc gggcgggcat ctcgccccgg tctacgaacc cgcggcgttc       780
     caccgcctga tccaggacaa cgtcaccctg cacgaaaagc tgagggcatc gcagctgtcg       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page