(data stored in ACNUC7421 zone)

EMBL: CP001700.PE515

CP001700.PE515       Location/Qualifiers
FT   CDS_pept        complement(612222..613028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0527"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: npu:Npun_F0780
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69470"
FT                   /db_xref="GOA:C7PXB9"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXB9"
FT                   /inference="protein motif:PFAM:PF00975"
FT                   /protein_id="ACU69470.1"
FT                   /translation="MTGAHSDKVGGGTVGGPRPAEPELRLFLFHHAGGSSSVFEGWESR
FT                   FPAGWDVRALDAPGRGAARSAKPCTTVEELAGYFRDHLSLSFDRPFSFFGHSMGAMVAY
FT                   ELARRLQAEGGPQPNWVGLSACRAPGQPAARGQHGLSNEDLRAWLAAAGGTDQLVLHHP
FT                   LIWKMLEPLLRADLRVVDSWQPTVDAVPLRGALSVFGAQDDRVLAHEKLIGWQPFTEHY
FT                   VASRLFRGGHFYLQRQADLIIRWIVADISGSRRVCATPWTSPAKTR"
     gtgaccggcg cccacagcga taaggtcggt ggcggcacag tcggcgggcc gcggcccgcc        60
     gagccggagc tgcggctgtt cctcttccat cacgccggcg gctccagctc ggtgttcgag       120
     ggctgggaaa gccgctttcc ggccgggtgg gacgtccggg ctttggacgc acccggccgg       180
     ggcgccgccc ggtcggcgaa accgtgcacg accgtcgagg aactcgccgg ctacttccgc       240
     gatcaccttt ctctgtcctt cgaccggccc ttctcgttct tcggccacag catgggcgcg       300
     atggtcgcgt acgaactcgc ccgccgccta caggccgagg gcggtccgca gccgaactgg       360
     gtgggtttgt ccgcgtgccg cgcgcctggc cagcccgcgg cccgcggaca gcacggcctg       420
     tcgaacgagg acctgcgcgc ctggctggcc gcggcgggcg ggacggatca gctggtgctg       480
     caccacccgc tgatctggaa gatgctcgag cccctgctgc gcgcggatct gcgggtggtc       540
     gactcctggc agcccaccgt cgacgccgtg ccgctgcgcg gcgcgctttc cgtcttcggc       600
     gcccaggacg atcgcgttct cgcgcacgag aagctgatcg gctggcagcc cttcaccgag       660
     cactacgtgg ccagccgtct gttccgcggc ggccacttct atctccagcg ccaagcggac       720
     ctgatcatac ggtggatcgt cgccgacatc tccggttcgc ggcgcgtgtg tgcgacccca       780
     tggacatccc cggcgaaaac gaggtga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page