(data stored in ACNUC7421 zone)

EMBL: CP001700.PE516

CP001700.PE516       Location/Qualifiers
FT   CDS_pept        complement(613035..613835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0528"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   stp:Strop_3280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC0"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACU69471.1"
FT                   /translation="MNGAPDWITADADTERPSIARFYDYLLGGTHHLEVDRELGRKAIR
FT                   AAPGLILLMRENRKFLRRAVKCALDAGIDQFLDIGSGIPARGSIHETARKAGSRARVAY
FT                   VDIDPVAVSEGKAILAGDPEGVSVLGDVFEPAAILENPEVRALIDLDRPVVLLILNVIH
FT                   FFPDSKVLPVLETYRHRLVSGSMLGLSVAMDGTTGAEAIDELYRQEYEGFTLRSREQIE
FT                   ALFGDFELLEPGVVYPPEWRPEDPGRTVVNPERYSSLVGVARKR"
     atgaacgggg ccccggactg gatcaccgcc gacgcggaca ccgaacgccc cagcatcgcg        60
     cgcttctacg actacctcct cggcgggacg caccacctcg aggtcgaccg cgagctcggc       120
     cgcaaggcca tccgcgcggc gcccggcctc atcctgctga tgcgggagaa ccgcaagttc       180
     ctgcggcggg cggtcaagtg cgccctggac gccgggatcg accagttcct cgacatcggc       240
     tcgggcatcc cggcccgcgg cagcatccac gagaccgcgc gcaaggccgg ctcgcgggcc       300
     cgggtggcct acgtcgatat cgacccggtg gccgtgtcgg agggcaaggc gatcctcgcc       360
     ggcgacccgg agggtgtcag cgtgctggga gacgtcttcg agcccgcggc catcctggag       420
     aacccggagg tgcgcgccct gatcgacctg gaccgcccgg tcgtgctgct gatcctcaat       480
     gtgatccatt tcttcccgga ctccaaggtg cttcccgtgc tggagacgta ccggcaccgc       540
     ctggtgtcgg gaagcatgct cggcctgtcg gtggccatgg acggcaccac cggcgccgag       600
     gcgatcgacg agctctaccg gcaggagtac gaggggttca ccctgcggtc ccgcgagcag       660
     atcgaggcgc tgttcggcga cttcgagctg ctcgagcccg gagtggtcta tccgccggag       720
     tggcggcccg aggacccggg ccggacggtg gtgaacccgg agcggtacag ctcgttggtc       780
     ggcgtcgcca ggaagcggtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page