(data stored in ACNUC7421 zone)

EMBL: CP001700.PE517

CP001700.PE517       Location/Qualifiers
FT   CDS_pept        complement(613832..614464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0529"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: mab:MAB_4054c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69472"
FT                   /db_xref="GOA:C7PXC1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC1"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACU69472.1"
FT                   /translation="MSKVYEKINHQMAGWIHRQPIFFVASAPLAASGRVNVSPKGLMGT
FT                   LVVLDPHSIAYLDYTGTGAETIAHLRENGRITVMFCAFEGRPKIVRLYGRGRYTVPGEP
FT                   EFDKLRELFEKTTTAGQRSIIIVDIDRITDSCGWSVPLMDYREDRAVLDLHNERRDDAY
FT                   FEKYWQTTNADSIDGLPALRSEPEPEPGLAPEPESEYLVVSASGSNE"
     gtgagcaagg tctacgagaa gatcaaccat cagatggcgg gctggatcca ccgccagccg        60
     atcttcttcg tcgcctcggc cccgctggcg gcctccggcc gcgtcaacgt ctcgcccaag       120
     ggcctcatgg gcacgctcgt cgtgctcgac ccgcacagca tcgcctacct cgactacacc       180
     ggcaccggcg cggagaccat cgcgcacctg cgggagaacg gccggatcac ggtgatgttc       240
     tgcgcgttcg agggccgtcc gaagatcgtc aggctctacg gccgcggccg ctacacggtg       300
     ccgggcgagc cggagttcga caagctgcgg gagctgttcg agaagacgac gacggcgggc       360
     cagcgctcga tcatcatcgt cgacatcgac cggatcaccg actcctgcgg atggtcggtg       420
     ccgctgatgg actaccggga agaccgggcg gtgctcgacc tgcacaacga gcgccgcgac       480
     gacgcctact tcgagaagta ctggcagacc acgaacgccg acagcatcga cgggttgccg       540
     gcgctgcggt ccgagcccga acccgaaccc gggctcgcac ccgagcccga gtcggaatac       600
     ctggtcgtat cggcttccgg gagcaacgaa tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page