(data stored in ACNUC7421 zone)

EMBL: CP001700.PE518

CP001700.PE518       Location/Qualifiers
FT   CDS_pept        complement(614461..615936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0530"
FT                   /product="tryptophan halogenase"
FT                   /note="PFAM: tryptophan halogenase; monooxygenase FAD-
FT                   binding; FAD dependent oxidoreductase; KEGG: fal:FRAAL4634
FT                   putative halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69473"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC2"
FT                   /inference="protein motif:PFAM:PF04820"
FT                   /protein_id="ACU69473.1"
FT                   /translation="MTEQNTVKTANDVDNPDNAEKTRVLVIGGGPGGSTAATLLARQGI
FT                   EVTLLESAIFPRYHIGESILPSVLPVLDLLGVREEVDNHGFVRKDGAYFEWGPENWDLN
FT                   FDHLSGASRHSYQVIRSEFDHMLLKNAQAKGVDVREGVKVTEILFHGDRPVAARWSASD
FT                   NSGAAGTIAFDFLVDASGRAGVMATKYLKNRRYHEAFKNVAVWSYWRDVKPLEVGPKGA
FT                   IAVCSVPYGWFWAIPLHDGTTSIGLVAKRTTFSDERERLGSIEAVYADAMTQAPRILEM
FT                   TQGANKIEGYKVEQDYSYVSERKSGPGYVLVGDAAAFLDPLLSTGVHLSTFSALLAAAS
FT                   VSAVLDGELAEQEAVDFYERAYHQAYERLLVVVSFFYNSYNRQTQFFEADKLTRRERHM
FT                   LNLYESFLHIVTGIEDLDDSIDGGEALEEVAQQIATQKKIDAGHNEAMNSLPDSPRQAV
FT                   GGLYLELEPRLRIRRTSEAPAGPEPVREARAGL"
     atgactgagc agaacacagt gaaaactgcg aacgacgtag acaacccgga caacgccgag        60
     aagacccgcg tgctggtcat cggcggcggc cccggcggct cgaccgccgc caccctgctg       120
     gcccggcagg gcatcgaggt gacgctgctg gagagcgcca tcttcccccg ctaccacatc       180
     ggcgagtcga tcctgccttc cgtactgccg gtgctggacc tgctcggagt ccgcgaggag       240
     gtcgacaacc acggcttcgt gcgcaaggac ggcgcctatt tcgagtgggg cccggagaac       300
     tgggacctga acttcgacca cctgtccggc gccagccggc acagctacca ggtgatccgg       360
     tccgagttcg accacatgct gctgaagaac gcccaggcca agggcgttga cgtgcgcgag       420
     ggcgtcaagg tcacggagat cctgttccac ggcgaccgcc ccgtcgcggc ccgctggtca       480
     gcctcggaca actccggggc cgccggcacc atcgcgttcg acttcctggt cgacgcctcg       540
     ggccgggccg gggtgatggc gaccaagtac ctgaagaacc gccgatacca cgaggccttc       600
     aagaacgtcg cggtctggtc ctactggcgc gacgtcaagc cgctggaggt cgggccgaag       660
     ggcgccatcg cggtctgctc ggtgccctac ggctggttct gggccattcc gctgcacgac       720
     ggcacgacct cgatcggcct ggtggccaag cgcaccacat tctccgacga gcgcgagcgg       780
     ctcggcagca tcgaggcggt ctacgccgac gcgatgaccc aggccccgcg gatcctggag       840
     atgacccagg gcgcgaacaa gatcgagggt tacaaggtcg agcaggacta ctcctacgtc       900
     tccgagcgca agtccggccc cggctacgtc ctggtcggcg acgcggccgc cttcctggac       960
     ccgctgctgt ccaccggggt gcacctgtcg acgttcagcg cgctgctcgc ggccgcctcg      1020
     gtctccgcgg tgctggacgg cgagctggcc gagcaggagg cggtggactt ctacgagcgg      1080
     gcctaccacc aggcctacga gcggctgctg gtggtcgtct ccttcttcta caacagctac      1140
     aaccggcaga cccagttctt cgaggccgac aagctgaccc ggcgcgagag gcacatgctg      1200
     aacctctacg agtctttcct gcacatcgtc accggcatcg aggacctgga cgactcgatc      1260
     gatggcggcg aggcgctgga ggaggtcgcg cagcagatcg cgacccagaa gaagatcgac      1320
     gccgggcaca acgaggcgat gaactcgctg ccggactcgc cgcggcaggc cgtcggcggg      1380
     ttgtacctgg aactggagcc ccggctacgc atccgccgca catccgaggc gcccgccggc      1440
     ccggagccgg tgcgggaagc gagggccggg ttgtga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page