(data stored in ACNUC7421 zone)

EMBL: CP001700.PE519

CP001700.PE519       Location/Qualifiers
FT   CDS_pept        complement(615936..616739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0531"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   hch:HCH_01667 phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69474"
FT                   /db_xref="GOA:C7PXC3"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC3"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ACU69474.1"
FT                   /translation="MTAARDPLGVDRADREHRHGDRAVARRPHPADALLRSVRRPRITS
FT                   FGRRIDVWVAAIRPDVDPDPDMPVLRAFLPEGELRRLSAIRHDAARVEYAAGRLLVRSV
FT                   LAERLRTPPTRLRIGEEPGGRPRLEPGPGGSPADDFNLSHSGGRLALSVSRNLRVGVDI
FT                   ERVDRTRPLEALARRYYTADEHALLNTYAGADAYAECWYRIWTTKEAHAKARGAGVRGM
FT                   TDPLDGHGTRWRRYPIPVAPGFAGSVVALHPSYLSVPHRLLGSDD"
     atgacggcag ctcgcgaccc gctcggggtg gatcgggcgg atcgggagca tcggcacggc        60
     gatcgtgcgg tggcaaggag gccgcacccg gccgacgcgc tgctgcggtc cgtcaggcgg       120
     ccgcgcatca catcgttcgg tcggcggatc gacgtctggg tcgcggccat ccggcccgat       180
     gtggatccgg accctgacat gccggtcctg cgtgccttcc tgccggaggg cgagctgcgg       240
     cggctgtccg cgatccgcca cgacgccgcg cgcgtggagt acgcggccgg gcggctgctt       300
     gtacgctccg tgctggccga gcgcctgcgc accccgccga cccggctccg gatcggcgag       360
     gagcccggcg gacgtccgcg cctggaaccc ggtccgggcg gcagtcccgc cgacgatttc       420
     aacctctccc actccggcgg ccgcctggcg ttgtccgtct cccggaacct gagggtcgga       480
     gtggacatcg aacgggtcga ccggacccgc ccgctcgaag cccttgcccg tcgttactac       540
     acggccgatg agcatgccct gctgaacacc tacgccggcg ccgacgcgta cgccgagtgc       600
     tggtaccgca tctggaccac gaaggaggcg cacgccaagg cccgcggggc cggcgtgcgc       660
     ggtatgaccg accccctcga cggccacgga acccgatggc gccggtatcc gatacccgtc       720
     gcgccgggct tcgccggcag cgtcgtggcg ctgcacccgt cgtatctgtc cgtcccgcac       780
     cgcttgcttg ggagtgatga ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page