(data stored in ACNUC7421 zone)

EMBL: CP001700.PE52

CP001700.PE52        Location/Qualifiers
FT   CDS_pept        complement(51292..52770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0052"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   sco:SCO3556 secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69007"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFR8"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACU69007.1"
FT                   /translation="MNALSSSPMSMPSPMSSPSPMSSPSPLSPVPLPGAERLRLNAALV
FT                   DRVRTRLATPPVRVDMQAILAALRAEGCMLDGRDLRAAAYQVRSELTGAGVLDRYLADP
FT                   EVTDVLVNAPDSVWIERAGTLSRADVRFPDEAAVRRLAQRLAAHAGRRLDDAAPCVDGI
FT                   LPDGARLHAVLPPIAARGTLISLRVPPRRAFTVDQLTAGGLTTEHGARLLRAVASEKVS
FT                   YLVTGGTGSGKTTLLGALLGLVPGDERIVITEECTEVVVDHPHVARLQCRIANQENRGA
FT                   VNLRTLVRQALRMRPDRVVVGEVRGPEVLELLAAMNTGHDGCAATMHANGVEDVVARVE
FT                   ALAAPAGMERSALHAQLNSAVQVVVHLVRDKGKRRLASIGVIDRGFGETEVLPAVDFDD
FT                   TGKATYGPGSDRLSFLLGFEVRESTDEAPKAKPPPPRLPVDDLEKLAGWEEALAVADRL
FT                   LPVLKNAANGGDSHVDEPFVADYGPSPTRRGGHR"
     atgaacgcgc tctcgtcgtc gccgatgtcc atgccctctc ccatgtcgtc gccctccccg        60
     atgtcgtcgc cctccccgct gtctccggtc ccgctgccgg gagcggagcg gctgcggctc       120
     aacgcagcac tcgtggatcg ggtccggacc cggctggcga ccccgccggt ccgggtcgac       180
     atgcaggcga tcctcgccgc gctgcgggcc gagggctgca tgctcgacgg ccgcgatctg       240
     cgcgctgcgg cgtaccaggt ccgctccgaa ctcaccggcg ccggcgtgct ggaccgctat       300
     ctggccgatc cggaggtcac cgacgtcctg gtcaacgcgc cggactcggt gtggatcgaa       360
     cgcgccggga cgttgagccg cgccgacgtg cgctttccgg acgaggcggc ggtgcggcgg       420
     ctcgcgcagc ggctggccgc ccacgccgga cgccggctcg acgacgcggc gccgtgcgtc       480
     gacgggatcc tgcccgacgg cgcgcggctg cacgcggtgc tgcctccgat cgccgcgcgg       540
     ggaacgctga tctccctgcg cgtcccacca cggcgggcgt tcaccgtgga ccagctcacc       600
     gccggcggac tgaccaccga gcacggcgcg cgcctgctgc gagccgtcgc ctcagagaag       660
     gtgtcctatc tggtcaccgg cgggaccggc agcggcaaga cgacgctgct cggcgcgctg       720
     ctcggtctgg tgccgggcga cgagcggatc gtcatcaccg aggaatgcac cgaggtggtc       780
     gtcgaccatc cccatgtggc gcggctgcaa tgccggatcg ccaatcagga gaaccgcggc       840
     gcggtgaacc tgcggacgct ggtacggcag gcgctgcgga tgcggccgga ccgggtggtg       900
     gtcggcgagg tgcgcgggcc cgaggtgttg gaactcctgg cagctatgaa caccgggcac       960
     gacggatgcg cggcgacgat gcacgccaac ggggtcgagg acgtcgtggc ccgcgtcgaa      1020
     gccctcgccg ccccggccgg gatggagcgc agcgcgctgc atgcacagct gaactccgcg      1080
     gtgcaggtgg tcgtccatct ggtgcgagat aaggggaaac ggcggctcgc ctcgatcggc      1140
     gtcatcgacc gcgggttcgg ggagaccgag gtcctgcccg ccgtggactt cgatgacacg      1200
     ggcaaggcga cctatggtcc cggttcggac cgtctcagct tcctgttggg cttcgaggtc      1260
     cgggagagca ccgacgaagc cccgaaagcg aagccgccgc cgcctcggct tcccgtcgac      1320
     gatctggaga agttggctgg ttgggaggaa gcgctggccg tcgccgatcg tctgctgccg      1380
     gtcctcaaga acgcggcaaa cggtggcgac agtcacgtcg acgagccctt cgtcgcggac      1440
     tacggccctt caccaacgcg tcgaggaggc caccgatga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page