(data stored in ACNUC7421 zone)

EMBL: CP001700.PE520

CP001700.PE520       Location/Qualifiers
FT   CDS_pept        complement(616736..617584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0532"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   sgr:SGR_5183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69475"
FT                   /db_xref="GOA:C7PXC4"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC4"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /protein_id="ACU69475.1"
FT                   /translation="MANKTESAGTDRGLAVLRARDLELRDAIDAVVLSWAAEAGAARTA
FT                   YPPLLRTSDLAALDYWVNFPHLALLAVGADAGREKELAAADHSVIAPELLAPAEYALPS
FT                   AACYSAYLDLSGTRLDGAHKITTVATCFRRENHFEGLRRLLSFTMREVVCVGNREAVLE
FT                   HASSFKKRVGEFARRLGLPLEVQAATDPFFEKDAARTLMQQLFPVKEEFVFGGGLAIAS
FT                   VNFHRNFFGERCDIRLADGSPAFTSCVAFGLERWLAALTERFGRDDPALPERIAEAARW
FT                   T"
     atggcgaata agaccgagtc ggccgggacc gaccgcgggc tggccgtgct gcgggcccgg        60
     gacctggagc tgcgcgacgc gatcgacgcg gtcgtcctgt cctgggccgc cgaagccggg       120
     gccgcgcgaa cagcgtaccc gccgctgctg cggacctctg acctggccgc actcgactac       180
     tgggtgaact tcccgcacct ggctctgctg gccgtgggag ctgatgccgg ccgggagaag       240
     gagttggccg cggcggacca ctccgtcatc gcccccgagt tgctcgctcc ggccgagtac       300
     gcgctgccgt ccgcggcctg ctattcggcc tacctggacc tgtccggcac ccgcctggac       360
     ggtgcgcaca agatcaccac ggtcgccacc tgcttccggc gggagaacca cttcgagggg       420
     ctgcgcaggc tgctgagctt caccatgcgc gaggtggtct gcgtcggcaa ccgggaagcc       480
     gtgctcgaac acgcgtcgtc gttcaagaag cgcgtcggcg agttcgctcg gcgcctcggg       540
     ctgcccctgg aggtgcaggc ggcgaccgac ccgttcttcg agaaggacgc cgctcgaacg       600
     ctgatgcagc agctcttccc ggtcaaggag gagttcgtct tcggcggggg cttggccatc       660
     gcgtcggtga acttccaccg gaacttcttc ggcgagcgct gcgacatcag gctggccgac       720
     ggcagtccgg cgttcacctc gtgcgtggcg ttcggcctcg agcgctggct ggcggcgctc       780
     accgagcgct tcggccggga cgaccccgcg ctgcccgagc gcatcgccga ggccgctcgg       840
     tggacatga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page