(data stored in ACNUC7421 zone)

EMBL: CP001700.PE521

CP001700.PE521       Location/Qualifiers
FT   CDS_pept        complement(617574..617858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69476"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69476.1"
FT                   /translation="MSELTDTTASPVPSVPQEPAKDLVVEYLLAKRPELGTIDPDYDLI
FT                   DNRVLDSLGFVNFLYVLEEQTGREIALEEVSPEDFRTLRRIRARFFDGE"
     atgagcgagt tgaccgacac aaccgcttcc ccggtgccga gcgtgcccca ggagccggcc        60
     aaggacctgg tcgtcgagta cttgctggcc aagcgcccgg aactcggcac gatcgacccg       120
     gactacgacc tgatcgacaa ccgggtgctg gactccctcg gcttcgtcaa cttcctgtac       180
     gtgttggagg agcagaccgg acgggagatc gccctggaag aggtctcgcc ggaggacttc       240
     cgcacgctgc gccggatccg ggcgaggttc ttcgatggcg aataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page