(data stored in ACNUC7421 zone)

EMBL: CP001700.PE522

CP001700.PE522       Location/Qualifiers
FT   CDS_pept        complement(617855..618796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_1069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69477"
FT                   /db_xref="GOA:C7PXC6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC6"
FT                   /inference="similar to AA sequence:KEGG:Sden_1069"
FT                   /protein_id="ACU69477.1"
FT                   /translation="MTDSLTTTTSNAHAYLAALPDILGGDERFKTVLDRLTVMSERDYY
FT                   DPYKLFVWPESIPEDGYWMTPELMSVHGTEAGASLEQAQLRALSKWESVTFYSLNVHGI
FT                   RELLTSIVARIHMPGFEVASEYFHHIIGEENDHMWFFAKFCLLYAGKVYPDRSLSFAGP
FT                   GIPEADTFLLFARLLIFEELVDVFNQRMGEDQRLAPTIRKINSVHHQDESRHIAFGRQI
FT                   VALLHRDLRTRLDTAQLAELERYLKAYMRASVESLCNPAAFRDAGIPEPFAVRRAVIED
FT                   PAFQEHAARILKRSTSHMVSEGIFTDERTVAA"
     gtgaccgact cactgaccac gaccacctcg aacgcccacg cctaccttgc cgcgctgccg        60
     gacatcctcg gcggcgacga gcgtttcaag accgtgctgg accgcttgac cgtgatgtcc       120
     gagcgcgact actacgaccc ctacaagctc ttcgtctggc ccgaatcgat ccccgaagac       180
     ggctactgga tgacccctga actgatgagc gtgcatggca ccgaggccgg cgcgtcgctc       240
     gaacaggccc aactgcgcgc cctgagcaaa tgggagagcg tcacgttcta cagcctcaac       300
     gtgcacggga tcagggagct gctgacctcg atcgtggccc ggattcacat gcccggcttc       360
     gaggtggcct cggagtactt ccaccacatc atcggcgaag agaacgacca catgtggttc       420
     ttcgccaagt tctgccttct ctacgcgggc aaggtctacc cggaccggtc gctgtccttc       480
     gccggtcccg gcatccccga ggccgacacc ttcctgctgt tcgcccggct gctgatcttc       540
     gaggagctgg tcgacgtgtt caaccagcgg atgggcgagg accagcggct ggcaccgacg       600
     atccggaaga tcaactcggt gcaccaccag gacgaatccc ggcacatcgc cttcggccgg       660
     cagatcgtcg cgcttctgca ccgggacctg cgcacccggc tggacacggc gcagctcgct       720
     gagctcgaaa gatatctgaa ggcttatatg cgtgcctcgg tggagtcgct gtgcaacccg       780
     gccgccttcc gtgatgccgg cataccggag ccgttcgccg tgcgccgcgc ggtgatcgag       840
     gacccggcct tccaggagca cgcggcccgc atcctgaaac gctccacttc gcacatggtc       900
     agcgaaggaa tcttcaccga tgaaaggacg gtcgcggcat ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page