(data stored in ACNUC7421 zone)

EMBL: CP001700.PE523

CP001700.PE523       Location/Qualifiers
FT   CDS_pept        complement(618793..619875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3280 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69478"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69478.1"
FT                   /translation="MTAAAPEAGVREADRWLDALERTYLVPEDHRVGYFDRVAALDMLR
FT                   CGEEVLEELVKAGLPTLGESGAEWFDRFDLFNLALASGSQISVPEKAIKYALRWMHRGP
FT                   RTWTERLDWTFVVDLSCPLDTCGADPEWSHAQMLPEAVGGELYDWKVEPEGARMVGDQL
FT                   RYSGPGPLRFSGNVSTSGELMELRSPVLRKIIEDFFAVGYRWVRLPEPLQWEYQRLLDA
FT                   GVSPCISASLFLAREFEAAGYPAITRRGWLLGMLDLSHSWVEVTDDDGVVKPIDPIFTW
FT                   LTEYADKPHPDLAAASIGSRMNRLLPAAMAADGLMATHRCGGRDVTPRRKTMIRRRLST
FT                   DGPAGSAGAAGTASTAGVSL"
     gtgacggccg cggccccgga agccggggtc cgggaggccg accgctggct cgatgcgctg        60
     gagcgcacct acctggtccc cgaggaccac cgcgtcggct acttcgaccg ggtcgcggcg       120
     ctggacatgc tgcgctgcgg cgaggaggtc ctggaggagc tggtcaaggc cgggctgccg       180
     acgttgggcg agtccggcgc cgagtggttc gaccgcttcg acctgttcaa cctcgcgctg       240
     gcctccggtt cgcagatctc ggtcccggag aaggcgatca agtacgcgct gcgctggatg       300
     caccgcggcc cgcggacctg gaccgagcgg ctggactgga ccttcgtggt cgacctgtcc       360
     tgcccgctgg acacctgcgg cgcggatccc gaatggagcc acgcgcagat gctgcccgaa       420
     gccgtcggtg gcgagctcta cgactggaag gtggagcccg agggcgcgcg gatggttggc       480
     gaccagctgc gctacagcgg ccccggaccg ctgcgtttct ccggaaacgt gtccaccagc       540
     ggcgagctga tggagctgcg ctcgccggtg ctgcgcaaga tcatcgagga cttcttcgcg       600
     gtcggctacc gctgggtgcg gttgcccgaa ccgctgcagt gggagtacca gcggttgctg       660
     gacgccgggg tctccccgtg catctcggcg agtttgttcc tggcgcgcga gttcgaggcc       720
     gccggttatc cggcgatcac ccggcgcggc tggctgctgg gcatgctcga cctgtcccac       780
     tcctgggtcg aggtcaccga cgacgacggc gtggtcaagc cgatcgaccc gatcttcacc       840
     tggctcaccg agtatgccga caaaccgcat cctgacctcg ccgccgcctc gatcggctcg       900
     cgcatgaacc ggctgctgcc cgccgccatg gccgccgacg gcctgatggc aacgcaccgc       960
     tgcggcggcc gcgatgtgac cccgcgtcgc aagaccatga tccgcagaag gctgtccacc      1020
     gacggacccg ccggttcggc cggcgccgcc ggaaccgctt caacggccgg agtatccctg      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page