(data stored in ACNUC7421 zone)

EMBL: CP001700.PE524

CP001700.PE524       Location/Qualifiers
FT   CDS_pept        complement(619872..620138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0536"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: tte:TTE1471 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69479"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC8"
FT                   /inference="similar to AA sequence:KEGG:TTE1471"
FT                   /protein_id="ACU69479.1"
FT                   /translation="MQLYEQTVVRVQEIIGDMSPAKPETAGPELILIDDLGYDSIHFLE
FT                   LALALEAEFNLFEFDEEQAVGMITVGDVAHLIAKIVVAAEDPT"
     atgcagttgt atgagcagac tgtggtacgc gtgcaggaga tcatcggtga catgtcgccg        60
     gccaagccgg agaccgccgg acccgaactc atcctcatcg acgatctcgg ctacgactcg       120
     atccacttcc tcgagctcgc cttggccctg gaggcggagt tcaatctgtt cgagttcgac       180
     gaggagcagg ccgtcgggat gatcaccgtc ggcgacgtgg cgcacctgat cgccaagatc       240
     gtcgtcgcgg ccgaggaccc gacgtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page