(data stored in ACNUC7421 zone)

EMBL: CP001700.PE525

CP001700.PE525       Location/Qualifiers
FT   CDS_pept        complement(620305..621366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cau:Caur_3331 ribonucleotide-diphosphate
FT                   reductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69480"
FT                   /db_xref="GOA:C7PXC9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69480.1"
FT                   /translation="MSGGASTGTDGGSAQEGTAGSDTEGHAHDAHDEVGPPGRDGLRSL
FT                   PGSADLYNRWESRQWSVAGLDLARDRRRFAELRPFARREILSALAELEIGESCVTRTLS
FT                   ALADHAPDEADRLYLCTQMADEARHVRFFQSYLSDVAGIAAEQLEPHGAMGGESGFGVV
FT                   YDPLLTRHTAAVRTRPDDRRVWHVAVVSYHLLAEGLLAVAGLRALRALAKSCELTALSE
FT                   GLANVVRDEARHVTFGLAATRRGAQSGYADAIGEAYLDGLGAATRVLVNPARRAASPVL
FT                   PTALRAYAGNLAAEWSAANARMCRHVEVVGLAALDTSANLCWSSGLDAAFAEYRERWGA
FT                   HHPVARARQLGLV"
     atgagcggcg gggcgagcac ggggacggac ggcgggagcg cgcaggaagg cacggccggc        60
     tccgataccg aggggcacgc gcacgacgcg cacgacgagg ttgggccacc gggccgtgac       120
     ggcctgcgca gcctgcccgg ttccgcggat ctctacaacc ggtgggagtc ccggcagtgg       180
     agcgtcgcgg ggctcgacct cgcgcgggac cgccgacgct tcgctgagct caggccgttc       240
     gcccggcgcg agatcctgag cgcgctcgcc gaactcgaga tcggagagtc ctgcgtcacc       300
     cggacgctca gcgccctcgc ggaccacgcg ccggatgagg ccgaccgcct ctatctgtgt       360
     acacagatgg ccgacgaggc ccggcacgta cggttcttcc aaagctacct gtccgacgtc       420
     gcgggcatag ccgccgagca gctggaaccg cacggcgcga tgggcggcga gtccgggttc       480
     ggcgtggtgt acgacccgtt gctgacccgg cacaccgcag ccgtgcggac ccggcccgac       540
     gaccggcggg tctggcatgt cgcggtggtc tcctaccacc tgctcgccga ggggctgctc       600
     gctgtcgcag ggctgcgcgc gctgcgggcc ctggccaaga gctgcgagct gaccgcgctg       660
     tccgaggggc tcgcgaacgt cgtgcgtgac gaggcacggc atgtgacgtt cggcctggcc       720
     gcgacccggc gcggggcaca gtcgggatac gccgatgcga tcggcgaggc gtatctggac       780
     ggcctcggcg cggcgaccag ggtgctggtg aacccggccc ggcgcgcggc cagtccggtg       840
     ctgccgacgg cgctgcgcgc gtatgccggg aacctggccg cggagtggtc cgcggcgaac       900
     gcgcgaatgt gccggcatgt cgaggtggtc gggctcgcgg ccctggacac atcggccaac       960
     ctgtgttgga gcagcgggct cgacgccgcg ttcgctgagt accgggagcg ttggggtgcc      1020
     caccatccgg tggcacgggc ccgccagctg ggtctggtct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page