(data stored in ACNUC7421 zone)

EMBL: CP001700.PE526

CP001700.PE526       Location/Qualifiers
FT   CDS_pept        complement(621366..623102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0538"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   saq:Sare_3010 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69481"
FT                   /db_xref="GOA:C7PXD0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACU69481.1"
FT                   /translation="MLLNWLLMPNTETGLCILGRDGDWRRHSYADIAAAVRRAIWLLRD
FT                   RDVCAEDRVAIVLADPLHFVTAFMAALAVGAVPVPLAPPTALREADRYVAHVAETLRVA
FT                   RPDLVCTGAGHRAEVLAALAAAGCPAGVVDIADAAHVPADSGDPYRRKPSDSALLQFTS
FT                   GSSGTPKGVRVSWANLTANIAAIRSWMRWEDDDVFASWLPLHHDMGLVGALITSFAAGT
FT                   DLWLMTPRQFVRTPARWLECFGVHGATITTSPSFGYAHVAARVRAGELDGMDFSRWRVA
FT                   ILGAERIDPAAVADFQALVGRRGFDTSSLMGAYGLAEGTLLATGVPARAGSRLVKVVDW
FT                   ALTAGSPVAISQEGRLGRDAVQGAGWLASCGRAADGVAVTVVDDAGDEVPDGTFGEIRL
FT                   SGDSLAAGYLTRDGSVPFSARGSAADAPGADPVLDTGDAGFLLDGELYVVGRIGDALRV
FT                   HGHGVYAEDVEAELSRLGGEQGPAAYAAVFGTIGTRDLAAVFVEGDPPRTWSAKAEQRI
FT                   RTAASTDLPVLIFQGSKGSIARTSSGKPRRRHLWLRLLDGGVPDGWRLVHGEWPWPAGE
FT                   QS"
     atgctgttga actggctgtt gatgccgaat accgagaccg ggctgtgcat actgggccgt        60
     gacggggact ggcgccggca ttcgtatgct gatatagctg ccgctgttcg ccgggccata       120
     tggctcctgc gcgaccggga cgtgtgcgcc gaggaccgcg tcgcgatcgt gctggccgat       180
     cccctgcatt tcgtcaccgc cttcatggcg gcgctcgcgg tcggcgcggt gccggtgccg       240
     ctcgcaccgc cgaccgcgct gcgcgaagcc gaccgctacg tggcgcacgt ggccgaaaca       300
     ctgcgggtgg cccggcccga cctggtgtgc accggcgccg ggcaccgggc cgaggtcctg       360
     gccgcgctgg ccgccgcggg ttgtccggcg ggcgtggtcg acatcgccga cgccgcgcac       420
     gtgcccgccg actccgggga tccctaccgg cgcaagccct cggactcggc gctgctccag       480
     ttcacctccg gctcctccgg caccccaaag ggcgtgcggg tctcctgggc gaacctgacg       540
     gcgaacatcg cggcgatccg ctcctggatg cgctgggagg acgacgacgt cttcgccagc       600
     tggctgccgc tacatcacga catgggcctg gtcggcgcgc tgatcacctc cttcgccgcc       660
     gggacggatc tgtggctgat gacgccgcgt cagttcgtcc gcacgcccgc gcgctggctg       720
     gagtgcttcg gcgtccacgg cgccaccatc accacgtcgc cgagcttcgg ctacgcccac       780
     gtggcggccc gggtccgagc cggcgagctg gacggcatgg acttctcgcg gtggcgagtc       840
     gcgatcctcg gcgccgagcg gatcgacccg gcggcggtgg cggacttcca ggcgttggtg       900
     ggtcggcgcg gattcgacac ctcgtcgctg atgggggcgt acggcctggc cgagggcacg       960
     ctcctggcca ccggtgtgcc cgcccgggct ggttcgcggc tggtgaaggt cgtggactgg      1020
     gcgctgacgg ccggctcccc ggtcgcgatc agccaggagg gcagactcgg acgggacgcg      1080
     gtccagggcg ccgggtggct cgcgagctgc ggccgcgcgg ccgacggcgt cgccgtgacg      1140
     gtcgtcgacg acgccgggga cgaggtgccc gacgggacct tcggtgaaat acgcctgtcg      1200
     ggcgattcgc tggcggccgg gtacctgacg cgggacggtt cagttccctt ctcggcgcgg      1260
     ggctcagcgg cggacgcgcc gggtgcggac cctgtcctgg acaccgggga cgccggattt      1320
     ctgctcgacg gggagcttta cgtcgtcggg cgcatcggcg acgcgctgcg ggtgcacggg      1380
     cacggcgtct acgccgagga cgtggaggcg gagctttccc ggctcggcgg tgagcagggg      1440
     cccgccgcgt acgcggcggt cttcggcacg atcgggaccc gtgacctcgc ggcggtgttc      1500
     gtcgagggcg atccgccccg gacctggtcg gccaaagccg agcagcggat ccgcaccgcg      1560
     gcctcgaccg acctcccggt cctgatcttc caaggctcga agggctccat cgcccggacg      1620
     tcgagcggca agccccgccg gcgccacctg tggctgagac tgctcgacgg aggcgtaccc      1680
     gacggttggc gtctggtgca cggcgaatgg ccctggccgg cgggggagca gagctga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page