(data stored in ACNUC7421 zone)

EMBL: CP001700.PE527

CP001700.PE527       Location/Qualifiers
FT   CDS_pept        complement(623267..624508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0539"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   kpe:KPK_1427 transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69482"
FT                   /db_xref="GOA:C7PXD1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7PXD1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69482.1"
FT                   /translation="MASSEQGKHVTQVQPPPVRRLWSAVFFGYLALGATLQELPGYMTS
FT                   KFGDGPTIIGVAVGIAYLGTAVTRPFAGRAGDAGLARNVSVAGGAITTLAALGQLTAPS
FT                   ALVLIIFRLLMGIGEGALFSGCLPWVLTGIAADRRGRIAGWFGLSMWGGLALGPLAAVG
FT                   VNHLGGSTATWWTIFGLPLVSSVLIASTRPQPAVSPRREIRPQGWRDIVPIGVSVPGIV
FT                   LGLAAYGYGTLNALLVLYLTHDHIGGQGIGLTVFAVAFLATRAAGSPLTDQYGGIRVAR
FT                   VTLVVEIAGLCVLAASSSQGGALAGCVVTGIGLGVIYPSTSKITLGRTGPLQAGVSMGT
FT                   MTSFWDLGIMAAGPISGAVAAHLGYREGFGVAAAVTVAALVLTVLGLHTDSPAEAPTSV
FT                   PRSVPAGAQVRPRA"
     atggcgtcga gcgagcaggg gaaacatgtg acgcaggtgc agcctccacc agtgcggcgg        60
     ctgtggtccg ccgtcttctt cgggtacctc gcgctggggg cgacgctcca ggaactgccc       120
     ggctacatga cgtcgaagtt cggcgacggc cccacgatca tcggcgtcgc ggtgggcatc       180
     gcctacctgg gcaccgccgt gacccgaccg ttcgccggcc gggccgggga cgcggggctg       240
     gccaggaacg tctccgtagc cggcggcgcg atcaccacgc tggccgccct cggccagctg       300
     accgccccgt ccgcgctcgt gctgatcatt ttccggctgc tgatgggcat cggcgagggg       360
     gcgctgttct ccggctgcct gccctgggtg ctcacgggga tcgcggccga ccggcgcggc       420
     cggatcgcgg gctggttcgg actgtcgatg tggggcggcc tggcgctcgg gccgctggcc       480
     gcggtcgggg tgaaccacct cggcgggtcg accgcgacgt ggtggacgat cttcggcctg       540
     ccgctggttt ccagcgtgct gatcgcctcc accaggccgc agcccgcggt ctcgccccga       600
     cgcgagatcc ggccgcaggg ctggcgggac atcgtgccga tcggcgtcag cgtgccgggc       660
     atcgtgctcg ggctcgccgc ctacggctac ggcaccctga acgcactgct cgtcctttat       720
     ttgacgcacg accacatcgg cggccagggc atcggcctga ccgtgttcgc cgtggcgttc       780
     ctggccacac gcgccgccgg cagccccctg accgaccagt acggcggcat ccgggtcgcc       840
     cgggtcacgc tggtcgtcga gatcgccggg ctctgcgttc tggccgcctc ctcctcccag       900
     ggcggtgcgc tggccggctg tgtcgtcacc ggcatcgggc tcggcgtcat ctatccgtcc       960
     accagcaaga tcacactcgg ccgcaccggt ccgctgcagg ccggcgtgtc gatgggcacg      1020
     atgacctcgt tctgggacct ggggatcatg gcggccgggc cgatcagcgg cgcggtcgcg      1080
     gcgcacctgg ggtaccggga gggcttcggg gtcgcggcgg cggtgaccgt cgcggcgctg      1140
     gtgctcacgg tgctggggct gcatacggac tccccggcgg aggcgcccac gtcggtgccg      1200
     cggtcggtcc cggctggcgc gcaggtgcgc ccgcgcgcct ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page